Cargando…

True metabolizable energy and amino acid digestibility in black soldier fly larvae meals, cricket meal, and mealworms using a precision-fed rooster assay

Six precision-fed rooster assays were conducted to determine nutrient composition, nitrogen-corrected true metabolizable energy (TME(n)) and standardized amino acid digestibility for three black soldier fly larvae meals (BSFL), one partially-defatted BSFL, one cricket meal and two mealworm meals. Th...

Descripción completa

Detalles Bibliográficos
Autores principales: Matin, N., Utterback, P., Parsons, C.M.
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Elsevier 2021
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8182423/
https://www.ncbi.nlm.nih.gov/pubmed/34087699
http://dx.doi.org/10.1016/j.psj.2021.101146
_version_ 1783704204342198272
author Matin, N.
Utterback, P.
Parsons, C.M.
author_facet Matin, N.
Utterback, P.
Parsons, C.M.
author_sort Matin, N.
collection PubMed
description Six precision-fed rooster assays were conducted to determine nutrient composition, nitrogen-corrected true metabolizable energy (TME(n)) and standardized amino acid digestibility for three black soldier fly larvae meals (BSFL), one partially-defatted BSFL, one cricket meal and two mealworm meals. The TME(n) values were determined in three 48-h rooster assays using conventional roosters and the standardized amino acid digestibility values were determined in three 48-h rooster assays using cecectomized roosters. Nutrient analysis (DM basis) of the meals indicated that the CP varied from 45 to 58% among the four BSFL, was 67% for the cricket meal and varied from 51 to 56% for the two mealworms. Crude fat (12–30%), total P (0.7–1.1%), Ca (0.04–3.6%), and neutral detergent fiber (10–36%) also varied among the insect meals. The TME(n) values for the three BSFL were generally consistent and averaged 4079 kcal/kg DM. As expected, partially-defatted BSFL contained a lower level of TME(n). The TMEn of the cricket meal was 4223 kcal/kg DM. Due to their low fiber content and high fat content, the TME(n) values for the two mealworms were high and in excess of 5000 kcal/kg DM. Amino acid concentrations of the various insect meals ranged from 0.69 to 1.1% for methionine, 0.57 to 0.73% for cystine, 3.3 to 4.5% for lysine, and 1.9 to 2.6% for threonine. Standardized amino acid digestibility values were generally high (most were 85–95%) for the four BSFL and two mealworms. Digestibility values for most amino acids were slightly lower for the cricket meal. Digestibility of cystine and valine were generally lower and more variable than other amino acids in the seven insect meals. The results of this study indicated that nutrient composition varies substantially among different insect meals, but all insect meals contained high levels of TME(n) and digestible amino acids compared with feed ingredients commonly used in poultry diets.
format Online
Article
Text
id pubmed-8182423
institution National Center for Biotechnology Information
language English
publishDate 2021
publisher Elsevier
record_format MEDLINE/PubMed
spelling pubmed-81824232021-06-16 True metabolizable energy and amino acid digestibility in black soldier fly larvae meals, cricket meal, and mealworms using a precision-fed rooster assay Matin, N. Utterback, P. Parsons, C.M. Poult Sci METABOLISM AND NUTRITION Six precision-fed rooster assays were conducted to determine nutrient composition, nitrogen-corrected true metabolizable energy (TME(n)) and standardized amino acid digestibility for three black soldier fly larvae meals (BSFL), one partially-defatted BSFL, one cricket meal and two mealworm meals. The TME(n) values were determined in three 48-h rooster assays using conventional roosters and the standardized amino acid digestibility values were determined in three 48-h rooster assays using cecectomized roosters. Nutrient analysis (DM basis) of the meals indicated that the CP varied from 45 to 58% among the four BSFL, was 67% for the cricket meal and varied from 51 to 56% for the two mealworms. Crude fat (12–30%), total P (0.7–1.1%), Ca (0.04–3.6%), and neutral detergent fiber (10–36%) also varied among the insect meals. The TME(n) values for the three BSFL were generally consistent and averaged 4079 kcal/kg DM. As expected, partially-defatted BSFL contained a lower level of TME(n). The TMEn of the cricket meal was 4223 kcal/kg DM. Due to their low fiber content and high fat content, the TME(n) values for the two mealworms were high and in excess of 5000 kcal/kg DM. Amino acid concentrations of the various insect meals ranged from 0.69 to 1.1% for methionine, 0.57 to 0.73% for cystine, 3.3 to 4.5% for lysine, and 1.9 to 2.6% for threonine. Standardized amino acid digestibility values were generally high (most were 85–95%) for the four BSFL and two mealworms. Digestibility values for most amino acids were slightly lower for the cricket meal. Digestibility of cystine and valine were generally lower and more variable than other amino acids in the seven insect meals. The results of this study indicated that nutrient composition varies substantially among different insect meals, but all insect meals contained high levels of TME(n) and digestible amino acids compared with feed ingredients commonly used in poultry diets. Elsevier 2021-03-21 /pmc/articles/PMC8182423/ /pubmed/34087699 http://dx.doi.org/10.1016/j.psj.2021.101146 Text en © 2021 The Authors https://creativecommons.org/licenses/by/4.0/This is an open access article under the CC BY license (http://creativecommons.org/licenses/by/4.0/).
spellingShingle METABOLISM AND NUTRITION
Matin, N.
Utterback, P.
Parsons, C.M.
True metabolizable energy and amino acid digestibility in black soldier fly larvae meals, cricket meal, and mealworms using a precision-fed rooster assay
title True metabolizable energy and amino acid digestibility in black soldier fly larvae meals, cricket meal, and mealworms using a precision-fed rooster assay
title_full True metabolizable energy and amino acid digestibility in black soldier fly larvae meals, cricket meal, and mealworms using a precision-fed rooster assay
title_fullStr True metabolizable energy and amino acid digestibility in black soldier fly larvae meals, cricket meal, and mealworms using a precision-fed rooster assay
title_full_unstemmed True metabolizable energy and amino acid digestibility in black soldier fly larvae meals, cricket meal, and mealworms using a precision-fed rooster assay
title_short True metabolizable energy and amino acid digestibility in black soldier fly larvae meals, cricket meal, and mealworms using a precision-fed rooster assay
title_sort true metabolizable energy and amino acid digestibility in black soldier fly larvae meals, cricket meal, and mealworms using a precision-fed rooster assay
topic METABOLISM AND NUTRITION
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8182423/
https://www.ncbi.nlm.nih.gov/pubmed/34087699
http://dx.doi.org/10.1016/j.psj.2021.101146
work_keys_str_mv AT matinn truemetabolizableenergyandaminoaciddigestibilityinblacksoldierflylarvaemealscricketmealandmealwormsusingaprecisionfedroosterassay
AT utterbackp truemetabolizableenergyandaminoaciddigestibilityinblacksoldierflylarvaemealscricketmealandmealwormsusingaprecisionfedroosterassay
AT parsonscm truemetabolizableenergyandaminoaciddigestibilityinblacksoldierflylarvaemealscricketmealandmealwormsusingaprecisionfedroosterassay