Cargando…

Clostridioides difficile specific DNA adenine methyltransferase CamA squeezes and flips adenine out of DNA helix

Clostridioides difficile infections are an urgent medical problem. The newly discovered C. difficile adenine methyltransferase A (CamA) is specified by all C. difficile genomes sequenced to date (>300), but is rare among other bacteria. CamA is an orphan methyltransferase, unassociated with a res...

Descripción completa

Detalles Bibliográficos
Autores principales: Zhou, Jujun, Horton, John R., Blumenthal, Robert M., Zhang, Xing, Cheng, Xiaodong
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Nature Publishing Group UK 2021
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8187626/
https://www.ncbi.nlm.nih.gov/pubmed/34103525
http://dx.doi.org/10.1038/s41467-021-23693-w
_version_ 1783705170034556928
author Zhou, Jujun
Horton, John R.
Blumenthal, Robert M.
Zhang, Xing
Cheng, Xiaodong
author_facet Zhou, Jujun
Horton, John R.
Blumenthal, Robert M.
Zhang, Xing
Cheng, Xiaodong
author_sort Zhou, Jujun
collection PubMed
description Clostridioides difficile infections are an urgent medical problem. The newly discovered C. difficile adenine methyltransferase A (CamA) is specified by all C. difficile genomes sequenced to date (>300), but is rare among other bacteria. CamA is an orphan methyltransferase, unassociated with a restriction endonuclease. CamA-mediated methylation at CAAAAA is required for normal sporulation, biofilm formation, and intestinal colonization by C. difficile. We characterized CamA kinetic parameters, and determined its structure bound to DNA containing the recognition sequence. CamA contains an N-terminal domain for catalyzing methyl transfer, and a C-terminal DNA recognition domain. Major and minor groove DNA contacts in the recognition site involve base-specific hydrogen bonds, van der Waals contacts and the Watson-Crick pairing of a rearranged A:T base pair. These provide sufficient sequence discrimination to ensure high specificity. Finally, the surprisingly weak binding of the methyl donor S-adenosyl-l-methionine (SAM) might provide avenues for inhibiting CamA activity using SAM analogs.
format Online
Article
Text
id pubmed-8187626
institution National Center for Biotechnology Information
language English
publishDate 2021
publisher Nature Publishing Group UK
record_format MEDLINE/PubMed
spelling pubmed-81876262021-07-01 Clostridioides difficile specific DNA adenine methyltransferase CamA squeezes and flips adenine out of DNA helix Zhou, Jujun Horton, John R. Blumenthal, Robert M. Zhang, Xing Cheng, Xiaodong Nat Commun Article Clostridioides difficile infections are an urgent medical problem. The newly discovered C. difficile adenine methyltransferase A (CamA) is specified by all C. difficile genomes sequenced to date (>300), but is rare among other bacteria. CamA is an orphan methyltransferase, unassociated with a restriction endonuclease. CamA-mediated methylation at CAAAAA is required for normal sporulation, biofilm formation, and intestinal colonization by C. difficile. We characterized CamA kinetic parameters, and determined its structure bound to DNA containing the recognition sequence. CamA contains an N-terminal domain for catalyzing methyl transfer, and a C-terminal DNA recognition domain. Major and minor groove DNA contacts in the recognition site involve base-specific hydrogen bonds, van der Waals contacts and the Watson-Crick pairing of a rearranged A:T base pair. These provide sufficient sequence discrimination to ensure high specificity. Finally, the surprisingly weak binding of the methyl donor S-adenosyl-l-methionine (SAM) might provide avenues for inhibiting CamA activity using SAM analogs. Nature Publishing Group UK 2021-06-08 /pmc/articles/PMC8187626/ /pubmed/34103525 http://dx.doi.org/10.1038/s41467-021-23693-w Text en © The Author(s) 2021 https://creativecommons.org/licenses/by/4.0/Open Access This article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The images or other third party material in this article are included in the article’s Creative Commons license, unless indicated otherwise in a credit line to the material. If material is not included in the article’s Creative Commons license and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this license, visit http://creativecommons.org/licenses/by/4.0/ (https://creativecommons.org/licenses/by/4.0/) .
spellingShingle Article
Zhou, Jujun
Horton, John R.
Blumenthal, Robert M.
Zhang, Xing
Cheng, Xiaodong
Clostridioides difficile specific DNA adenine methyltransferase CamA squeezes and flips adenine out of DNA helix
title Clostridioides difficile specific DNA adenine methyltransferase CamA squeezes and flips adenine out of DNA helix
title_full Clostridioides difficile specific DNA adenine methyltransferase CamA squeezes and flips adenine out of DNA helix
title_fullStr Clostridioides difficile specific DNA adenine methyltransferase CamA squeezes and flips adenine out of DNA helix
title_full_unstemmed Clostridioides difficile specific DNA adenine methyltransferase CamA squeezes and flips adenine out of DNA helix
title_short Clostridioides difficile specific DNA adenine methyltransferase CamA squeezes and flips adenine out of DNA helix
title_sort clostridioides difficile specific dna adenine methyltransferase cama squeezes and flips adenine out of dna helix
topic Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8187626/
https://www.ncbi.nlm.nih.gov/pubmed/34103525
http://dx.doi.org/10.1038/s41467-021-23693-w
work_keys_str_mv AT zhoujujun clostridioidesdifficilespecificdnaadeninemethyltransferasecamasqueezesandflipsadenineoutofdnahelix
AT hortonjohnr clostridioidesdifficilespecificdnaadeninemethyltransferasecamasqueezesandflipsadenineoutofdnahelix
AT blumenthalrobertm clostridioidesdifficilespecificdnaadeninemethyltransferasecamasqueezesandflipsadenineoutofdnahelix
AT zhangxing clostridioidesdifficilespecificdnaadeninemethyltransferasecamasqueezesandflipsadenineoutofdnahelix
AT chengxiaodong clostridioidesdifficilespecificdnaadeninemethyltransferasecamasqueezesandflipsadenineoutofdnahelix