Cargando…
Surgical site infection prevention and management in immunocompromised patients: a systematic review of the literature
BACKGROUND: Immunocompromised patients are at higher risk of surgical site infection and wound complications. However, optimal management in the perioperative period is not well established. Present systematic review aims to analyse existing strategies and interventions to prevent and manage surgica...
Autores principales: | , , , , , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2021
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8194010/ https://www.ncbi.nlm.nih.gov/pubmed/34112231 http://dx.doi.org/10.1186/s13017-021-00375-y |
_version_ | 1783706336294338560 |
---|---|
author | Coccolini, Federico Improta, Mario Cicuttin, Enrico Catena, Fausto Sartelli, Massimo Bova, Raffaele de’ Angelis, Nicola Gitto, Stefano Tartaglia, Dario Cremonini, Camilla Ordonez, Carlos Baiocchi, Gian Luca Chiarugi, Massimo |
author_facet | Coccolini, Federico Improta, Mario Cicuttin, Enrico Catena, Fausto Sartelli, Massimo Bova, Raffaele de’ Angelis, Nicola Gitto, Stefano Tartaglia, Dario Cremonini, Camilla Ordonez, Carlos Baiocchi, Gian Luca Chiarugi, Massimo |
author_sort | Coccolini, Federico |
collection | PubMed |
description | BACKGROUND: Immunocompromised patients are at higher risk of surgical site infection and wound complications. However, optimal management in the perioperative period is not well established. Present systematic review aims to analyse existing strategies and interventions to prevent and manage surgical site infections and other wound complications in immunocompromised patients. METHODS: A systematic review of the literature was conducted. RESULTS: Literature review shows that partial skin closure is effective to reduce SSI in this population. There is not sufficient evidence to definitively suggest in favour of prophylactic negative pressure wound therapy. The use of mammalian target of rapamycin (mTOR) and calcineurin inhibitors (CNI) in transplanted patient needing ad emergent or undeferrable abdominal surgical procedure must be carefully and multidisciplinary evaluated. The role of antibiotic prophylaxis in transplanted patients needs to be assessed. CONCLUSION: Strict adherence to SSI infection preventing bundles must be implemented worldwide especially in immunocompromised patients. Lastly, it is necessary to elaborate a more widely approved definition of immunocompromised state. Without such shared definition, it will be hard to elaborate the needed methodologically correct studies for this fragile population. |
format | Online Article Text |
id | pubmed-8194010 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2021 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-81940102021-06-15 Surgical site infection prevention and management in immunocompromised patients: a systematic review of the literature Coccolini, Federico Improta, Mario Cicuttin, Enrico Catena, Fausto Sartelli, Massimo Bova, Raffaele de’ Angelis, Nicola Gitto, Stefano Tartaglia, Dario Cremonini, Camilla Ordonez, Carlos Baiocchi, Gian Luca Chiarugi, Massimo World J Emerg Surg Review BACKGROUND: Immunocompromised patients are at higher risk of surgical site infection and wound complications. However, optimal management in the perioperative period is not well established. Present systematic review aims to analyse existing strategies and interventions to prevent and manage surgical site infections and other wound complications in immunocompromised patients. METHODS: A systematic review of the literature was conducted. RESULTS: Literature review shows that partial skin closure is effective to reduce SSI in this population. There is not sufficient evidence to definitively suggest in favour of prophylactic negative pressure wound therapy. The use of mammalian target of rapamycin (mTOR) and calcineurin inhibitors (CNI) in transplanted patient needing ad emergent or undeferrable abdominal surgical procedure must be carefully and multidisciplinary evaluated. The role of antibiotic prophylaxis in transplanted patients needs to be assessed. CONCLUSION: Strict adherence to SSI infection preventing bundles must be implemented worldwide especially in immunocompromised patients. Lastly, it is necessary to elaborate a more widely approved definition of immunocompromised state. Without such shared definition, it will be hard to elaborate the needed methodologically correct studies for this fragile population. BioMed Central 2021-06-10 /pmc/articles/PMC8194010/ /pubmed/34112231 http://dx.doi.org/10.1186/s13017-021-00375-y Text en © The Author(s) 2021 https://creativecommons.org/licenses/by/4.0/Open AccessThis article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/ (https://creativecommons.org/licenses/by/4.0/) . The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/ (https://creativecommons.org/publicdomain/zero/1.0/) ) applies to the data made available in this article, unless otherwise stated in a credit line to the data. |
spellingShingle | Review Coccolini, Federico Improta, Mario Cicuttin, Enrico Catena, Fausto Sartelli, Massimo Bova, Raffaele de’ Angelis, Nicola Gitto, Stefano Tartaglia, Dario Cremonini, Camilla Ordonez, Carlos Baiocchi, Gian Luca Chiarugi, Massimo Surgical site infection prevention and management in immunocompromised patients: a systematic review of the literature |
title | Surgical site infection prevention and management in immunocompromised patients: a systematic review of the literature |
title_full | Surgical site infection prevention and management in immunocompromised patients: a systematic review of the literature |
title_fullStr | Surgical site infection prevention and management in immunocompromised patients: a systematic review of the literature |
title_full_unstemmed | Surgical site infection prevention and management in immunocompromised patients: a systematic review of the literature |
title_short | Surgical site infection prevention and management in immunocompromised patients: a systematic review of the literature |
title_sort | surgical site infection prevention and management in immunocompromised patients: a systematic review of the literature |
topic | Review |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8194010/ https://www.ncbi.nlm.nih.gov/pubmed/34112231 http://dx.doi.org/10.1186/s13017-021-00375-y |
work_keys_str_mv | AT coccolinifederico surgicalsiteinfectionpreventionandmanagementinimmunocompromisedpatientsasystematicreviewoftheliterature AT improtamario surgicalsiteinfectionpreventionandmanagementinimmunocompromisedpatientsasystematicreviewoftheliterature AT cicuttinenrico surgicalsiteinfectionpreventionandmanagementinimmunocompromisedpatientsasystematicreviewoftheliterature AT catenafausto surgicalsiteinfectionpreventionandmanagementinimmunocompromisedpatientsasystematicreviewoftheliterature AT sartellimassimo surgicalsiteinfectionpreventionandmanagementinimmunocompromisedpatientsasystematicreviewoftheliterature AT bovaraffaele surgicalsiteinfectionpreventionandmanagementinimmunocompromisedpatientsasystematicreviewoftheliterature AT deangelisnicola surgicalsiteinfectionpreventionandmanagementinimmunocompromisedpatientsasystematicreviewoftheliterature AT gittostefano surgicalsiteinfectionpreventionandmanagementinimmunocompromisedpatientsasystematicreviewoftheliterature AT tartagliadario surgicalsiteinfectionpreventionandmanagementinimmunocompromisedpatientsasystematicreviewoftheliterature AT cremoninicamilla surgicalsiteinfectionpreventionandmanagementinimmunocompromisedpatientsasystematicreviewoftheliterature AT ordonezcarlos surgicalsiteinfectionpreventionandmanagementinimmunocompromisedpatientsasystematicreviewoftheliterature AT baiocchigianluca surgicalsiteinfectionpreventionandmanagementinimmunocompromisedpatientsasystematicreviewoftheliterature AT chiarugimassimo surgicalsiteinfectionpreventionandmanagementinimmunocompromisedpatientsasystematicreviewoftheliterature |