Cargando…

Evaluating the Chichewa version of the London Measure of Unplanned Pregnancy in Malawi: a validation update

OBJECTIVE: To investigate the psychometric properties of the validated Chichewa version of the London Measure of Unplanned Pregnancy in a large representative community-based sample in Malawi, a low-income country. We collected data on pregnancy intention from a cohort of 4244 pregnant women in Mala...

Descripción completa

Detalles Bibliográficos
Autores principales: Hall, Jennifer A., Stephenson, Judith, Barrett, Geraldine
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2021
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8194220/
https://www.ncbi.nlm.nih.gov/pubmed/34112219
http://dx.doi.org/10.1186/s13104-021-05645-1
_version_ 1783706375152467968
author Hall, Jennifer A.
Stephenson, Judith
Barrett, Geraldine
author_facet Hall, Jennifer A.
Stephenson, Judith
Barrett, Geraldine
author_sort Hall, Jennifer A.
collection PubMed
description OBJECTIVE: To investigate the psychometric properties of the validated Chichewa version of the London Measure of Unplanned Pregnancy in a large representative community-based sample in Malawi, a low-income country. We collected data on pregnancy intention from a cohort of 4244 pregnant women in Malawi using the validated Chichewa version of the London Measure of Unplanned Pregnancy (LMUP). We evaluated the psychometric properties of the Chichewa LMUP using classical test theory and confirmatory factor analysis to re-assess the performance of items one and six, which had weaker performance in the original smaller, facility-based validation sample. RESULTS: The Chichewa version of the LMUP met all pre-set criteria for validation. There are now nine validations of the LMUP in different low-and-middle-income countries, confirming the validity and applicability of the LMUP in these settings.
format Online
Article
Text
id pubmed-8194220
institution National Center for Biotechnology Information
language English
publishDate 2021
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-81942202021-06-15 Evaluating the Chichewa version of the London Measure of Unplanned Pregnancy in Malawi: a validation update Hall, Jennifer A. Stephenson, Judith Barrett, Geraldine BMC Res Notes Research Note OBJECTIVE: To investigate the psychometric properties of the validated Chichewa version of the London Measure of Unplanned Pregnancy in a large representative community-based sample in Malawi, a low-income country. We collected data on pregnancy intention from a cohort of 4244 pregnant women in Malawi using the validated Chichewa version of the London Measure of Unplanned Pregnancy (LMUP). We evaluated the psychometric properties of the Chichewa LMUP using classical test theory and confirmatory factor analysis to re-assess the performance of items one and six, which had weaker performance in the original smaller, facility-based validation sample. RESULTS: The Chichewa version of the LMUP met all pre-set criteria for validation. There are now nine validations of the LMUP in different low-and-middle-income countries, confirming the validity and applicability of the LMUP in these settings. BioMed Central 2021-06-10 /pmc/articles/PMC8194220/ /pubmed/34112219 http://dx.doi.org/10.1186/s13104-021-05645-1 Text en © The Author(s) 2021 https://creativecommons.org/licenses/by/4.0/Open AccessThis article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/ (https://creativecommons.org/licenses/by/4.0/) . The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/ (https://creativecommons.org/publicdomain/zero/1.0/) ) applies to the data made available in this article, unless otherwise stated in a credit line to the data.
spellingShingle Research Note
Hall, Jennifer A.
Stephenson, Judith
Barrett, Geraldine
Evaluating the Chichewa version of the London Measure of Unplanned Pregnancy in Malawi: a validation update
title Evaluating the Chichewa version of the London Measure of Unplanned Pregnancy in Malawi: a validation update
title_full Evaluating the Chichewa version of the London Measure of Unplanned Pregnancy in Malawi: a validation update
title_fullStr Evaluating the Chichewa version of the London Measure of Unplanned Pregnancy in Malawi: a validation update
title_full_unstemmed Evaluating the Chichewa version of the London Measure of Unplanned Pregnancy in Malawi: a validation update
title_short Evaluating the Chichewa version of the London Measure of Unplanned Pregnancy in Malawi: a validation update
title_sort evaluating the chichewa version of the london measure of unplanned pregnancy in malawi: a validation update
topic Research Note
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8194220/
https://www.ncbi.nlm.nih.gov/pubmed/34112219
http://dx.doi.org/10.1186/s13104-021-05645-1
work_keys_str_mv AT halljennifera evaluatingthechichewaversionofthelondonmeasureofunplannedpregnancyinmalawiavalidationupdate
AT stephensonjudith evaluatingthechichewaversionofthelondonmeasureofunplannedpregnancyinmalawiavalidationupdate
AT barrettgeraldine evaluatingthechichewaversionofthelondonmeasureofunplannedpregnancyinmalawiavalidationupdate