Cargando…
Clinical, laboratory, and genetic markers for the development or presence of psoriatic arthritis in psoriasis patients: a systematic review
Twenty to thirty percent of psoriasis (Pso) patients will develop psoriatic arthritis (PsA). Detection of Pso patients that are (at risk for) developing PsA is essential to prevent structural damage. We conducted a systematic search of five bibliographic databases, up to May 2020. We searched for st...
Autores principales: | , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2021
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8201808/ https://www.ncbi.nlm.nih.gov/pubmed/34127053 http://dx.doi.org/10.1186/s13075-021-02545-4 |
_version_ | 1783707871870976000 |
---|---|
author | Mulder, Michelle L. M. van Hal, Tamara W. Wenink, Mark H. Koenen, Hans J. P. M. van den Hoogen, Frank H. J. de Jong, Elke M. G. J. van den Reek, Juul M. P. A. Vriezekolk, Johanna E. |
author_facet | Mulder, Michelle L. M. van Hal, Tamara W. Wenink, Mark H. Koenen, Hans J. P. M. van den Hoogen, Frank H. J. de Jong, Elke M. G. J. van den Reek, Juul M. P. A. Vriezekolk, Johanna E. |
author_sort | Mulder, Michelle L. M. |
collection | PubMed |
description | Twenty to thirty percent of psoriasis (Pso) patients will develop psoriatic arthritis (PsA). Detection of Pso patients that are (at risk for) developing PsA is essential to prevent structural damage. We conducted a systematic search of five bibliographic databases, up to May 2020. We searched for studies assessing markers (clinical, laboratory, genetic) associated with the development or presence of PsA in Pso patients. Study selection and quality assessment of the included studies was performed, followed by a qualitative best evidence synthesis to determine the level of evidence for a marker and its association with concomitant/developing PsA in Pso. Overall, 259 possible markers were identified in 119 studies that met the inclusion criteria. Laboratory markers related to inflammation and bone metabolism reached a strong level of evidence for the association (not prediction) of PsA in Pso. Only CXCL10 showed strong evidence for a positive predictive value for PsA in Pso. The importance of timely detecting PsA in a Pso population, and finding more (bio)markers contributing to early detection, remains high. SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1186/s13075-021-02545-4. |
format | Online Article Text |
id | pubmed-8201808 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2021 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-82018082021-06-16 Clinical, laboratory, and genetic markers for the development or presence of psoriatic arthritis in psoriasis patients: a systematic review Mulder, Michelle L. M. van Hal, Tamara W. Wenink, Mark H. Koenen, Hans J. P. M. van den Hoogen, Frank H. J. de Jong, Elke M. G. J. van den Reek, Juul M. P. A. Vriezekolk, Johanna E. Arthritis Res Ther Review Twenty to thirty percent of psoriasis (Pso) patients will develop psoriatic arthritis (PsA). Detection of Pso patients that are (at risk for) developing PsA is essential to prevent structural damage. We conducted a systematic search of five bibliographic databases, up to May 2020. We searched for studies assessing markers (clinical, laboratory, genetic) associated with the development or presence of PsA in Pso patients. Study selection and quality assessment of the included studies was performed, followed by a qualitative best evidence synthesis to determine the level of evidence for a marker and its association with concomitant/developing PsA in Pso. Overall, 259 possible markers were identified in 119 studies that met the inclusion criteria. Laboratory markers related to inflammation and bone metabolism reached a strong level of evidence for the association (not prediction) of PsA in Pso. Only CXCL10 showed strong evidence for a positive predictive value for PsA in Pso. The importance of timely detecting PsA in a Pso population, and finding more (bio)markers contributing to early detection, remains high. SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1186/s13075-021-02545-4. BioMed Central 2021-06-14 2021 /pmc/articles/PMC8201808/ /pubmed/34127053 http://dx.doi.org/10.1186/s13075-021-02545-4 Text en © The Author(s) 2021 https://creativecommons.org/licenses/by/4.0/Open AccessThis article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/ (https://creativecommons.org/licenses/by/4.0/) . The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/ (https://creativecommons.org/publicdomain/zero/1.0/) ) applies to the data made available in this article, unless otherwise stated in a credit line to the data. |
spellingShingle | Review Mulder, Michelle L. M. van Hal, Tamara W. Wenink, Mark H. Koenen, Hans J. P. M. van den Hoogen, Frank H. J. de Jong, Elke M. G. J. van den Reek, Juul M. P. A. Vriezekolk, Johanna E. Clinical, laboratory, and genetic markers for the development or presence of psoriatic arthritis in psoriasis patients: a systematic review |
title | Clinical, laboratory, and genetic markers for the development or presence of psoriatic arthritis in psoriasis patients: a systematic review |
title_full | Clinical, laboratory, and genetic markers for the development or presence of psoriatic arthritis in psoriasis patients: a systematic review |
title_fullStr | Clinical, laboratory, and genetic markers for the development or presence of psoriatic arthritis in psoriasis patients: a systematic review |
title_full_unstemmed | Clinical, laboratory, and genetic markers for the development or presence of psoriatic arthritis in psoriasis patients: a systematic review |
title_short | Clinical, laboratory, and genetic markers for the development or presence of psoriatic arthritis in psoriasis patients: a systematic review |
title_sort | clinical, laboratory, and genetic markers for the development or presence of psoriatic arthritis in psoriasis patients: a systematic review |
topic | Review |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8201808/ https://www.ncbi.nlm.nih.gov/pubmed/34127053 http://dx.doi.org/10.1186/s13075-021-02545-4 |
work_keys_str_mv | AT muldermichellelm clinicallaboratoryandgeneticmarkersforthedevelopmentorpresenceofpsoriaticarthritisinpsoriasispatientsasystematicreview AT vanhaltamaraw clinicallaboratoryandgeneticmarkersforthedevelopmentorpresenceofpsoriaticarthritisinpsoriasispatientsasystematicreview AT weninkmarkh clinicallaboratoryandgeneticmarkersforthedevelopmentorpresenceofpsoriaticarthritisinpsoriasispatientsasystematicreview AT koenenhansjpm clinicallaboratoryandgeneticmarkersforthedevelopmentorpresenceofpsoriaticarthritisinpsoriasispatientsasystematicreview AT vandenhoogenfrankhj clinicallaboratoryandgeneticmarkersforthedevelopmentorpresenceofpsoriaticarthritisinpsoriasispatientsasystematicreview AT dejongelkemgj clinicallaboratoryandgeneticmarkersforthedevelopmentorpresenceofpsoriaticarthritisinpsoriasispatientsasystematicreview AT vandenreekjuulmpa clinicallaboratoryandgeneticmarkersforthedevelopmentorpresenceofpsoriaticarthritisinpsoriasispatientsasystematicreview AT vriezekolkjohannae clinicallaboratoryandgeneticmarkersforthedevelopmentorpresenceofpsoriaticarthritisinpsoriasispatientsasystematicreview |