Cargando…

The Stand-Alone PilZ-Domain Protein MotL Specifically Regulates the Activity of the Secondary Lateral Flagellar System in Shewanella putrefaciens

A number of bacterial species control the function of the flagellar motor in response to the levels of the secondary messenger c-di-GMP, which is often mediated by c-di-GMP-binding proteins that act as molecular brakes or clutches to slow the motor rotation. The gammaproteobacterium Shewanella putre...

Descripción completa

Detalles Bibliográficos
Autores principales: Pecina, Anna, Schwan, Meike, Blagotinsek, Vitan, Rick, Tim, Klüber, Patrick, Leonhard, Tabea, Bange, Gert, Thormann, Kai M.
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Frontiers Media S.A. 2021
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8203827/
https://www.ncbi.nlm.nih.gov/pubmed/34140945
http://dx.doi.org/10.3389/fmicb.2021.668892
_version_ 1783708251600191488
author Pecina, Anna
Schwan, Meike
Blagotinsek, Vitan
Rick, Tim
Klüber, Patrick
Leonhard, Tabea
Bange, Gert
Thormann, Kai M.
author_facet Pecina, Anna
Schwan, Meike
Blagotinsek, Vitan
Rick, Tim
Klüber, Patrick
Leonhard, Tabea
Bange, Gert
Thormann, Kai M.
author_sort Pecina, Anna
collection PubMed
description A number of bacterial species control the function of the flagellar motor in response to the levels of the secondary messenger c-di-GMP, which is often mediated by c-di-GMP-binding proteins that act as molecular brakes or clutches to slow the motor rotation. The gammaproteobacterium Shewanella putrefaciens possesses two distinct flagellar systems, the primary single polar flagellum and a secondary system with one to five lateral flagellar filaments. Here, we identified a protein, MotL, which specifically regulates the activity of the lateral, but not the polar, flagellar motors in response to the c-di-GMP levels. MotL only consists of a single PilZ domain binding c-di-GMP, which is crucial for its function. Deletion and overproduction analyses revealed that MotL slows down the lateral flagella at elevated levels of c-di-GMP, and may speed up the lateral flagellar-mediated movement at low c-di-GMP concentrations. In vitro interaction studies hint at an interaction of MotL with the C-ring of the lateral flagellar motors. This study shows a differential c-di-GMP-dependent regulation of the two flagellar systems in a single species, and implicates that PilZ domain-only proteins can also act as molecular regulators to control the flagella-mediated motility in bacteria.
format Online
Article
Text
id pubmed-8203827
institution National Center for Biotechnology Information
language English
publishDate 2021
publisher Frontiers Media S.A.
record_format MEDLINE/PubMed
spelling pubmed-82038272021-06-16 The Stand-Alone PilZ-Domain Protein MotL Specifically Regulates the Activity of the Secondary Lateral Flagellar System in Shewanella putrefaciens Pecina, Anna Schwan, Meike Blagotinsek, Vitan Rick, Tim Klüber, Patrick Leonhard, Tabea Bange, Gert Thormann, Kai M. Front Microbiol Microbiology A number of bacterial species control the function of the flagellar motor in response to the levels of the secondary messenger c-di-GMP, which is often mediated by c-di-GMP-binding proteins that act as molecular brakes or clutches to slow the motor rotation. The gammaproteobacterium Shewanella putrefaciens possesses two distinct flagellar systems, the primary single polar flagellum and a secondary system with one to five lateral flagellar filaments. Here, we identified a protein, MotL, which specifically regulates the activity of the lateral, but not the polar, flagellar motors in response to the c-di-GMP levels. MotL only consists of a single PilZ domain binding c-di-GMP, which is crucial for its function. Deletion and overproduction analyses revealed that MotL slows down the lateral flagella at elevated levels of c-di-GMP, and may speed up the lateral flagellar-mediated movement at low c-di-GMP concentrations. In vitro interaction studies hint at an interaction of MotL with the C-ring of the lateral flagellar motors. This study shows a differential c-di-GMP-dependent regulation of the two flagellar systems in a single species, and implicates that PilZ domain-only proteins can also act as molecular regulators to control the flagella-mediated motility in bacteria. Frontiers Media S.A. 2021-06-01 /pmc/articles/PMC8203827/ /pubmed/34140945 http://dx.doi.org/10.3389/fmicb.2021.668892 Text en Copyright © 2021 Pecina, Schwan, Blagotinsek, Rick, Klüber, Leonhard, Bange and Thormann. https://creativecommons.org/licenses/by/4.0/This is an open-access article distributed under the terms of the Creative Commons Attribution License (CC BY). The use, distribution or reproduction in other forums is permitted, provided the original author(s) and the copyright owner(s) are credited and that the original publication in this journal is cited, in accordance with accepted academic practice. No use, distribution or reproduction is permitted which does not comply with these terms.
spellingShingle Microbiology
Pecina, Anna
Schwan, Meike
Blagotinsek, Vitan
Rick, Tim
Klüber, Patrick
Leonhard, Tabea
Bange, Gert
Thormann, Kai M.
The Stand-Alone PilZ-Domain Protein MotL Specifically Regulates the Activity of the Secondary Lateral Flagellar System in Shewanella putrefaciens
title The Stand-Alone PilZ-Domain Protein MotL Specifically Regulates the Activity of the Secondary Lateral Flagellar System in Shewanella putrefaciens
title_full The Stand-Alone PilZ-Domain Protein MotL Specifically Regulates the Activity of the Secondary Lateral Flagellar System in Shewanella putrefaciens
title_fullStr The Stand-Alone PilZ-Domain Protein MotL Specifically Regulates the Activity of the Secondary Lateral Flagellar System in Shewanella putrefaciens
title_full_unstemmed The Stand-Alone PilZ-Domain Protein MotL Specifically Regulates the Activity of the Secondary Lateral Flagellar System in Shewanella putrefaciens
title_short The Stand-Alone PilZ-Domain Protein MotL Specifically Regulates the Activity of the Secondary Lateral Flagellar System in Shewanella putrefaciens
title_sort stand-alone pilz-domain protein motl specifically regulates the activity of the secondary lateral flagellar system in shewanella putrefaciens
topic Microbiology
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8203827/
https://www.ncbi.nlm.nih.gov/pubmed/34140945
http://dx.doi.org/10.3389/fmicb.2021.668892
work_keys_str_mv AT pecinaanna thestandalonepilzdomainproteinmotlspecificallyregulatestheactivityofthesecondarylateralflagellarsysteminshewanellaputrefaciens
AT schwanmeike thestandalonepilzdomainproteinmotlspecificallyregulatestheactivityofthesecondarylateralflagellarsysteminshewanellaputrefaciens
AT blagotinsekvitan thestandalonepilzdomainproteinmotlspecificallyregulatestheactivityofthesecondarylateralflagellarsysteminshewanellaputrefaciens
AT ricktim thestandalonepilzdomainproteinmotlspecificallyregulatestheactivityofthesecondarylateralflagellarsysteminshewanellaputrefaciens
AT kluberpatrick thestandalonepilzdomainproteinmotlspecificallyregulatestheactivityofthesecondarylateralflagellarsysteminshewanellaputrefaciens
AT leonhardtabea thestandalonepilzdomainproteinmotlspecificallyregulatestheactivityofthesecondarylateralflagellarsysteminshewanellaputrefaciens
AT bangegert thestandalonepilzdomainproteinmotlspecificallyregulatestheactivityofthesecondarylateralflagellarsysteminshewanellaputrefaciens
AT thormannkaim thestandalonepilzdomainproteinmotlspecificallyregulatestheactivityofthesecondarylateralflagellarsysteminshewanellaputrefaciens
AT pecinaanna standalonepilzdomainproteinmotlspecificallyregulatestheactivityofthesecondarylateralflagellarsysteminshewanellaputrefaciens
AT schwanmeike standalonepilzdomainproteinmotlspecificallyregulatestheactivityofthesecondarylateralflagellarsysteminshewanellaputrefaciens
AT blagotinsekvitan standalonepilzdomainproteinmotlspecificallyregulatestheactivityofthesecondarylateralflagellarsysteminshewanellaputrefaciens
AT ricktim standalonepilzdomainproteinmotlspecificallyregulatestheactivityofthesecondarylateralflagellarsysteminshewanellaputrefaciens
AT kluberpatrick standalonepilzdomainproteinmotlspecificallyregulatestheactivityofthesecondarylateralflagellarsysteminshewanellaputrefaciens
AT leonhardtabea standalonepilzdomainproteinmotlspecificallyregulatestheactivityofthesecondarylateralflagellarsysteminshewanellaputrefaciens
AT bangegert standalonepilzdomainproteinmotlspecificallyregulatestheactivityofthesecondarylateralflagellarsysteminshewanellaputrefaciens
AT thormannkaim standalonepilzdomainproteinmotlspecificallyregulatestheactivityofthesecondarylateralflagellarsysteminshewanellaputrefaciens