Cargando…
Hydrocele in a case of atypical Kawasaki disease: case report and review of diagnostic criteria
BACKGROUND: Kawasaki Disease (KD) is a self-limiting vasculitis of unknown etiology. Although there are well-recognized clinical features associated with classic KD, there have been increasing numbers of atypical clinical presentations with increased dependence on the American Heart Association diag...
Autores principales: | , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2021
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8204479/ https://www.ncbi.nlm.nih.gov/pubmed/34130639 http://dx.doi.org/10.1186/s12887-021-02758-1 |
_version_ | 1783708348449816576 |
---|---|
author | Tan, Y. R. L. Chow, C.-T. C. Ganesan, I. Leow, H. M. E. |
author_facet | Tan, Y. R. L. Chow, C.-T. C. Ganesan, I. Leow, H. M. E. |
author_sort | Tan, Y. R. L. |
collection | PubMed |
description | BACKGROUND: Kawasaki Disease (KD) is a self-limiting vasculitis of unknown etiology. Although there are well-recognized clinical features associated with classic KD, there have been increasing numbers of atypical clinical presentations with increased dependence on the American Heart Association diagnostic algorithm for incomplete KD. CASE PRESENTATION: We report on a child who was initially treated for Escherichia coli left pyelonephritis and Influenza A and Rhinovirus / Enterovirus upper respiratory tract infection. The child developed an acute hydrocele and a maculopapular rash during the illness course, which prompted further evaluation for concomitant atypical KD, although there were no other physical signs suggestive of classic KD at the time. Subsequent diagnosis of atypical KD was made with confirmation on echocardiography, with timely administration of intravenous immunoglobulin. CONCLUSIONS: Although there are well recognized clinical features associated with classic Kawasaki Disease, there have been increasing numbers of atypical clinical presentations with increased dependence on the American Heart Association diagnostic algorithm for incomplete Kawasaki Disease. This case report highlights the importance of considering a diagnosis of KD in a child with prolonged fever and unexplainable symptoms suggestive of inflammation, in this case, the rare presentation of an acute hydrocele. We recommend that for any child with prolonged unexplained fever, Kawasaki Disease should be considered. TRIAL REGISTRATION: Not applicable. |
format | Online Article Text |
id | pubmed-8204479 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2021 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-82044792021-06-16 Hydrocele in a case of atypical Kawasaki disease: case report and review of diagnostic criteria Tan, Y. R. L. Chow, C.-T. C. Ganesan, I. Leow, H. M. E. BMC Pediatr Case Report BACKGROUND: Kawasaki Disease (KD) is a self-limiting vasculitis of unknown etiology. Although there are well-recognized clinical features associated with classic KD, there have been increasing numbers of atypical clinical presentations with increased dependence on the American Heart Association diagnostic algorithm for incomplete KD. CASE PRESENTATION: We report on a child who was initially treated for Escherichia coli left pyelonephritis and Influenza A and Rhinovirus / Enterovirus upper respiratory tract infection. The child developed an acute hydrocele and a maculopapular rash during the illness course, which prompted further evaluation for concomitant atypical KD, although there were no other physical signs suggestive of classic KD at the time. Subsequent diagnosis of atypical KD was made with confirmation on echocardiography, with timely administration of intravenous immunoglobulin. CONCLUSIONS: Although there are well recognized clinical features associated with classic Kawasaki Disease, there have been increasing numbers of atypical clinical presentations with increased dependence on the American Heart Association diagnostic algorithm for incomplete Kawasaki Disease. This case report highlights the importance of considering a diagnosis of KD in a child with prolonged fever and unexplainable symptoms suggestive of inflammation, in this case, the rare presentation of an acute hydrocele. We recommend that for any child with prolonged unexplained fever, Kawasaki Disease should be considered. TRIAL REGISTRATION: Not applicable. BioMed Central 2021-06-15 /pmc/articles/PMC8204479/ /pubmed/34130639 http://dx.doi.org/10.1186/s12887-021-02758-1 Text en © The Author(s) 2021 https://creativecommons.org/licenses/by/4.0/Open AccessThis article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/ (https://creativecommons.org/licenses/by/4.0/) . The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/ (https://creativecommons.org/publicdomain/zero/1.0/) ) applies to the data made available in this article, unless otherwise stated in a credit line to the data. |
spellingShingle | Case Report Tan, Y. R. L. Chow, C.-T. C. Ganesan, I. Leow, H. M. E. Hydrocele in a case of atypical Kawasaki disease: case report and review of diagnostic criteria |
title | Hydrocele in a case of atypical Kawasaki disease: case report and review of diagnostic criteria |
title_full | Hydrocele in a case of atypical Kawasaki disease: case report and review of diagnostic criteria |
title_fullStr | Hydrocele in a case of atypical Kawasaki disease: case report and review of diagnostic criteria |
title_full_unstemmed | Hydrocele in a case of atypical Kawasaki disease: case report and review of diagnostic criteria |
title_short | Hydrocele in a case of atypical Kawasaki disease: case report and review of diagnostic criteria |
title_sort | hydrocele in a case of atypical kawasaki disease: case report and review of diagnostic criteria |
topic | Case Report |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8204479/ https://www.ncbi.nlm.nih.gov/pubmed/34130639 http://dx.doi.org/10.1186/s12887-021-02758-1 |
work_keys_str_mv | AT tanyrl hydroceleinacaseofatypicalkawasakidiseasecasereportandreviewofdiagnosticcriteria AT chowctc hydroceleinacaseofatypicalkawasakidiseasecasereportandreviewofdiagnosticcriteria AT ganesani hydroceleinacaseofatypicalkawasakidiseasecasereportandreviewofdiagnosticcriteria AT leowhme hydroceleinacaseofatypicalkawasakidiseasecasereportandreviewofdiagnosticcriteria |