Cargando…

Association between physical activity and mortality in end-stage kidney disease: a systematic review of observational studies

BACKGROUND: End-stage Kidney Disease patients have a high mortality and hospitalization risk. The association of these outcomes with physical activity is described in the general population and in other chronic diseases. However, few studies examining this association have been completed in end-stag...

Descripción completa

Detalles Bibliográficos
Autores principales: Martins, Pedro, Marques, Elisa A., Leal, Diogo V., Ferreira, Aníbal, Wilund, Kenneth R, Viana, João L.
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2021
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8212466/
https://www.ncbi.nlm.nih.gov/pubmed/34144689
http://dx.doi.org/10.1186/s12882-021-02407-w
_version_ 1783709644614533120
author Martins, Pedro
Marques, Elisa A.
Leal, Diogo V.
Ferreira, Aníbal
Wilund, Kenneth R
Viana, João L.
author_facet Martins, Pedro
Marques, Elisa A.
Leal, Diogo V.
Ferreira, Aníbal
Wilund, Kenneth R
Viana, João L.
author_sort Martins, Pedro
collection PubMed
description BACKGROUND: End-stage Kidney Disease patients have a high mortality and hospitalization risk. The association of these outcomes with physical activity is described in the general population and in other chronic diseases. However, few studies examining this association have been completed in end-stage Kidney Disease patients, raising the need to systematically review the evidence on the association of physical activity with mortality and hospitalization in this population. METHODS: Electronic databases (EBSCO, Scopus and Web of Science) and hand search were performed until March 2020 for observational studies reporting the association of physical activity with mortality or hospitalization in adult end-stage Kidney Disease patients on renal replacement therapy (hemodialysis, peritoneal dialysis and kidney transplant). Methodological quality of the included studies was assessed using the Quality in Prognosis Studies tool. The review protocol was registered in PROSPERO (CRD42020155591). RESULTS: Eleven studies were included: six in hemodialysis, three in kidney transplant, and two in hemodialysis and peritoneal dialysis patients. Physical activity was self-reported, except in one study that used accelerometers. All-cause mortality was addressed in all studies and cardiovascular mortality in three studies. Nine studies reported a significant reduction in all-cause mortality with increased levels of physical activity. Evidence of a dose-response relationship was found. For cardiovascular mortality, a significant reduction was observed in two of the three studies. Only one study investigated the association of physical activity with hospitalization. CONCLUSIONS: Higher physical activity was associated with reduced mortality in end-stage Kidney Disease patients. Future studies using objective physical activity measures could strengthen these findings. The association of physical activity with hospitalization should be explored in future investigations. SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1186/s12882-021-02407-w.
format Online
Article
Text
id pubmed-8212466
institution National Center for Biotechnology Information
language English
publishDate 2021
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-82124662021-06-22 Association between physical activity and mortality in end-stage kidney disease: a systematic review of observational studies Martins, Pedro Marques, Elisa A. Leal, Diogo V. Ferreira, Aníbal Wilund, Kenneth R Viana, João L. BMC Nephrol Research BACKGROUND: End-stage Kidney Disease patients have a high mortality and hospitalization risk. The association of these outcomes with physical activity is described in the general population and in other chronic diseases. However, few studies examining this association have been completed in end-stage Kidney Disease patients, raising the need to systematically review the evidence on the association of physical activity with mortality and hospitalization in this population. METHODS: Electronic databases (EBSCO, Scopus and Web of Science) and hand search were performed until March 2020 for observational studies reporting the association of physical activity with mortality or hospitalization in adult end-stage Kidney Disease patients on renal replacement therapy (hemodialysis, peritoneal dialysis and kidney transplant). Methodological quality of the included studies was assessed using the Quality in Prognosis Studies tool. The review protocol was registered in PROSPERO (CRD42020155591). RESULTS: Eleven studies were included: six in hemodialysis, three in kidney transplant, and two in hemodialysis and peritoneal dialysis patients. Physical activity was self-reported, except in one study that used accelerometers. All-cause mortality was addressed in all studies and cardiovascular mortality in three studies. Nine studies reported a significant reduction in all-cause mortality with increased levels of physical activity. Evidence of a dose-response relationship was found. For cardiovascular mortality, a significant reduction was observed in two of the three studies. Only one study investigated the association of physical activity with hospitalization. CONCLUSIONS: Higher physical activity was associated with reduced mortality in end-stage Kidney Disease patients. Future studies using objective physical activity measures could strengthen these findings. The association of physical activity with hospitalization should be explored in future investigations. SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1186/s12882-021-02407-w. BioMed Central 2021-06-18 /pmc/articles/PMC8212466/ /pubmed/34144689 http://dx.doi.org/10.1186/s12882-021-02407-w Text en © The Author(s) 2021 https://creativecommons.org/licenses/by/4.0/Open AccessThis article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/ (https://creativecommons.org/licenses/by/4.0/) . The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/ (https://creativecommons.org/publicdomain/zero/1.0/) ) applies to the data made available in this article, unless otherwise stated in a credit line to the data.
spellingShingle Research
Martins, Pedro
Marques, Elisa A.
Leal, Diogo V.
Ferreira, Aníbal
Wilund, Kenneth R
Viana, João L.
Association between physical activity and mortality in end-stage kidney disease: a systematic review of observational studies
title Association between physical activity and mortality in end-stage kidney disease: a systematic review of observational studies
title_full Association between physical activity and mortality in end-stage kidney disease: a systematic review of observational studies
title_fullStr Association between physical activity and mortality in end-stage kidney disease: a systematic review of observational studies
title_full_unstemmed Association between physical activity and mortality in end-stage kidney disease: a systematic review of observational studies
title_short Association between physical activity and mortality in end-stage kidney disease: a systematic review of observational studies
title_sort association between physical activity and mortality in end-stage kidney disease: a systematic review of observational studies
topic Research
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8212466/
https://www.ncbi.nlm.nih.gov/pubmed/34144689
http://dx.doi.org/10.1186/s12882-021-02407-w
work_keys_str_mv AT martinspedro associationbetweenphysicalactivityandmortalityinendstagekidneydiseaseasystematicreviewofobservationalstudies
AT marqueselisaa associationbetweenphysicalactivityandmortalityinendstagekidneydiseaseasystematicreviewofobservationalstudies
AT lealdiogov associationbetweenphysicalactivityandmortalityinendstagekidneydiseaseasystematicreviewofobservationalstudies
AT ferreiraanibal associationbetweenphysicalactivityandmortalityinendstagekidneydiseaseasystematicreviewofobservationalstudies
AT wilundkennethr associationbetweenphysicalactivityandmortalityinendstagekidneydiseaseasystematicreviewofobservationalstudies
AT vianajoaol associationbetweenphysicalactivityandmortalityinendstagekidneydiseaseasystematicreviewofobservationalstudies