Cargando…
Vitamin D status and vitamin D deficiency risk factors among pregnancy of Shanghai in China
BACKGROUND: There is increasing awareness that vitamin D deficiency in pregnant women may be associated with several adverse effects for the mother and newborn. The risks for vitamin D deficiency are unclear. This study was to assess vitamin D nutritional status and vitamin D deficiency risk factors...
Autores principales: | , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2021
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8214247/ https://www.ncbi.nlm.nih.gov/pubmed/34144704 http://dx.doi.org/10.1186/s12884-021-03889-0 |
_version_ | 1783710023792197632 |
---|---|
author | Yang, Chun Jing, Wu Ge, Sheng Sun, Wenguang |
author_facet | Yang, Chun Jing, Wu Ge, Sheng Sun, Wenguang |
author_sort | Yang, Chun |
collection | PubMed |
description | BACKGROUND: There is increasing awareness that vitamin D deficiency in pregnant women may be associated with several adverse effects for the mother and newborn. The risks for vitamin D deficiency are unclear. This study was to assess vitamin D nutritional status and vitamin D deficiency risk factors among pregnant women in Shanghai in China. METHODS: This study is a cross-sectional study conducted in the Sixth Affiliated People’s Hospital of Shanghai Jiao Tong University. A total of 953 healthy pregnant women participated, serological examinations and other variables included serum 25-hydroxyvitamin D [25(OH)D], total blood cholesterol (TCh), high-density lipoprotein (HDL), low-density lipoprotein (LDL), and very-low-density lipoprotein (VLDL) cholesterol, triglycerides at the first antenatal visit (12–14 weeks) pregnancy parity and age, body mass index (BMI) before pregnancy, and completed OGTTs test. Associations between vitamin D deficiency and possible predictors (age group, pre-pregnancy BMI, parity, and gestational hyperlipemia) were assessed with a multinomial logistic regression analysis. And also used to investigate the effects of 25(OH)D and the other variables on the occurrence of gestational diabetes mellitus. RESULTS: The mean vitamin D level of pregnancy was 16 (a range from 11 to 21) ng/ml, and severe vitamin D deficiency was 31.8% (303); vitamin D deficiency was 40.7% (388); vitamin D insufficiency was 25.1% (239); normal vitamin D was 2.4%(23). Vitamin D deficiency risk factors were age over 30, parity over 2, overweight, obese, and hyperlipemia. The increasing level of vitamin D nutritional status in pregnancy is significantly related to reducing gestational diabetes mellitus. Vitamin D deficiency is a risk factor for gestational diabetes mellitus. CONCLUSIONS: It is a high prevalence of vitamin D deficiency in Chinese pregnancy in Shanghai. Aging more than 30 years, the parity of more than 2, overweight and obesity, and hyperlipemia are risk factors for vitamin D deficiency. Vitamin D deficiency is a risk factor for gestational diabetes mellitus. Public health strategies to prevent vitamin D deficiency should focus on those risks to promote health pregnancy of Shanghai in China. |
format | Online Article Text |
id | pubmed-8214247 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2021 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-82142472021-06-23 Vitamin D status and vitamin D deficiency risk factors among pregnancy of Shanghai in China Yang, Chun Jing, Wu Ge, Sheng Sun, Wenguang BMC Pregnancy Childbirth Research BACKGROUND: There is increasing awareness that vitamin D deficiency in pregnant women may be associated with several adverse effects for the mother and newborn. The risks for vitamin D deficiency are unclear. This study was to assess vitamin D nutritional status and vitamin D deficiency risk factors among pregnant women in Shanghai in China. METHODS: This study is a cross-sectional study conducted in the Sixth Affiliated People’s Hospital of Shanghai Jiao Tong University. A total of 953 healthy pregnant women participated, serological examinations and other variables included serum 25-hydroxyvitamin D [25(OH)D], total blood cholesterol (TCh), high-density lipoprotein (HDL), low-density lipoprotein (LDL), and very-low-density lipoprotein (VLDL) cholesterol, triglycerides at the first antenatal visit (12–14 weeks) pregnancy parity and age, body mass index (BMI) before pregnancy, and completed OGTTs test. Associations between vitamin D deficiency and possible predictors (age group, pre-pregnancy BMI, parity, and gestational hyperlipemia) were assessed with a multinomial logistic regression analysis. And also used to investigate the effects of 25(OH)D and the other variables on the occurrence of gestational diabetes mellitus. RESULTS: The mean vitamin D level of pregnancy was 16 (a range from 11 to 21) ng/ml, and severe vitamin D deficiency was 31.8% (303); vitamin D deficiency was 40.7% (388); vitamin D insufficiency was 25.1% (239); normal vitamin D was 2.4%(23). Vitamin D deficiency risk factors were age over 30, parity over 2, overweight, obese, and hyperlipemia. The increasing level of vitamin D nutritional status in pregnancy is significantly related to reducing gestational diabetes mellitus. Vitamin D deficiency is a risk factor for gestational diabetes mellitus. CONCLUSIONS: It is a high prevalence of vitamin D deficiency in Chinese pregnancy in Shanghai. Aging more than 30 years, the parity of more than 2, overweight and obesity, and hyperlipemia are risk factors for vitamin D deficiency. Vitamin D deficiency is a risk factor for gestational diabetes mellitus. Public health strategies to prevent vitamin D deficiency should focus on those risks to promote health pregnancy of Shanghai in China. BioMed Central 2021-06-18 /pmc/articles/PMC8214247/ /pubmed/34144704 http://dx.doi.org/10.1186/s12884-021-03889-0 Text en © The Author(s) 2021 https://creativecommons.org/licenses/by/4.0/Open AccessThis article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/ (https://creativecommons.org/licenses/by/4.0/) . The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/ (https://creativecommons.org/publicdomain/zero/1.0/) ) applies to the data made available in this article, unless otherwise stated in a credit line to the data. |
spellingShingle | Research Yang, Chun Jing, Wu Ge, Sheng Sun, Wenguang Vitamin D status and vitamin D deficiency risk factors among pregnancy of Shanghai in China |
title | Vitamin D status and vitamin D deficiency risk factors among pregnancy of Shanghai in China |
title_full | Vitamin D status and vitamin D deficiency risk factors among pregnancy of Shanghai in China |
title_fullStr | Vitamin D status and vitamin D deficiency risk factors among pregnancy of Shanghai in China |
title_full_unstemmed | Vitamin D status and vitamin D deficiency risk factors among pregnancy of Shanghai in China |
title_short | Vitamin D status and vitamin D deficiency risk factors among pregnancy of Shanghai in China |
title_sort | vitamin d status and vitamin d deficiency risk factors among pregnancy of shanghai in china |
topic | Research |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8214247/ https://www.ncbi.nlm.nih.gov/pubmed/34144704 http://dx.doi.org/10.1186/s12884-021-03889-0 |
work_keys_str_mv | AT yangchun vitamindstatusandvitaminddeficiencyriskfactorsamongpregnancyofshanghaiinchina AT jingwu vitamindstatusandvitaminddeficiencyriskfactorsamongpregnancyofshanghaiinchina AT gesheng vitamindstatusandvitaminddeficiencyriskfactorsamongpregnancyofshanghaiinchina AT sunwenguang vitamindstatusandvitaminddeficiencyriskfactorsamongpregnancyofshanghaiinchina |