Cargando…
LRP10 interacts with SORL1 in the intracellular vesicle trafficking pathway in non-neuronal brain cells and localises to Lewy bodies in Parkinson’s disease and dementia with Lewy bodies
Loss-of-function variants in the low-density lipoprotein receptor-related protein 10 (LRP10) gene have been associated with autosomal-dominant Parkinson’s disease (PD), PD dementia, and dementia with Lewy bodies (DLB). Moreover, LRP10 variants have been found in individuals diagnosed with progressiv...
Autores principales: | , , , , , , , , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Springer Berlin Heidelberg
2021
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8217053/ https://www.ncbi.nlm.nih.gov/pubmed/33913039 http://dx.doi.org/10.1007/s00401-021-02313-3 |
_version_ | 1783710549391966208 |
---|---|
author | Grochowska, Martyna M. Carreras Mascaro, Ana Boumeester, Valerie Natale, Domenico Breedveld, Guido J. Geut, Hanneke van Cappellen, Wiggert A. Boon, Agnita J. W. Kievit, Anneke J. A. Sammler, Esther Parchi, Piero Cortelli, Pietro Alessi, Dario R. van de Berg, Wilma D. J. Bonifati, Vincenzo Mandemakers, Wim |
author_facet | Grochowska, Martyna M. Carreras Mascaro, Ana Boumeester, Valerie Natale, Domenico Breedveld, Guido J. Geut, Hanneke van Cappellen, Wiggert A. Boon, Agnita J. W. Kievit, Anneke J. A. Sammler, Esther Parchi, Piero Cortelli, Pietro Alessi, Dario R. van de Berg, Wilma D. J. Bonifati, Vincenzo Mandemakers, Wim |
author_sort | Grochowska, Martyna M. |
collection | PubMed |
description | Loss-of-function variants in the low-density lipoprotein receptor-related protein 10 (LRP10) gene have been associated with autosomal-dominant Parkinson’s disease (PD), PD dementia, and dementia with Lewy bodies (DLB). Moreover, LRP10 variants have been found in individuals diagnosed with progressive supranuclear palsy and amyotrophic lateral sclerosis. Despite this genetic evidence, little is known about the expression and function of LRP10 protein in the human brain under physiological or pathological conditions. To better understand how LRP10 variants lead to neurodegeneration, we first performed an in-depth characterisation of LRP10 expression in post-mortem brains and human-induced pluripotent stem cell (iPSC)-derived astrocytes and neurons from control subjects. In adult human brain, LRP10 is mainly expressed in astrocytes and neurovasculature but undetectable in neurons. Similarly, LRP10 is highly expressed in iPSC-derived astrocytes but cannot be observed in iPSC-derived neurons. In astrocytes, LRP10 is present at trans-Golgi network, plasma membrane, retromer, and early endosomes. Interestingly, LRP10 also partially co-localises and interacts with sortilin-related receptor 1 (SORL1). Furthermore, although LRP10 expression and localisation in the substantia nigra of most idiopathic PD and DLB patients and LRP10 variant carriers diagnosed with PD or DLB appeared unchanged compared to control subjects, significantly enlarged LRP10-positive vesicles were detected in a patient carrying the LRP10 p.Arg235Cys variant. Last, LRP10 was detected in Lewy bodies (LB) at late maturation stages in brains from idiopathic PD and DLB patients and in LRP10 variant carriers. In conclusion, high LRP10 expression in non-neuronal cells and undetectable levels in neurons of control subjects indicate that LRP10-mediated pathogenicity is initiated via cell non-autonomous mechanisms, potentially involving the interaction of LRP10 with SORL1 in vesicle trafficking pathways. Together with the specific pattern of LRP10 incorporation into mature LBs, these data support an important mechanistic role for disturbed vesicle trafficking and loss of LRP10 function in neurodegenerative diseases. SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1007/s00401-021-02313-3. |
format | Online Article Text |
id | pubmed-8217053 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2021 |
publisher | Springer Berlin Heidelberg |
record_format | MEDLINE/PubMed |
spelling | pubmed-82170532021-07-09 LRP10 interacts with SORL1 in the intracellular vesicle trafficking pathway in non-neuronal brain cells and localises to Lewy bodies in Parkinson’s disease and dementia with Lewy bodies Grochowska, Martyna M. Carreras Mascaro, Ana Boumeester, Valerie Natale, Domenico Breedveld, Guido J. Geut, Hanneke van Cappellen, Wiggert A. Boon, Agnita J. W. Kievit, Anneke J. A. Sammler, Esther Parchi, Piero Cortelli, Pietro Alessi, Dario R. van de Berg, Wilma D. J. Bonifati, Vincenzo Mandemakers, Wim Acta Neuropathol Original Paper Loss-of-function variants in the low-density lipoprotein receptor-related protein 10 (LRP10) gene have been associated with autosomal-dominant Parkinson’s disease (PD), PD dementia, and dementia with Lewy bodies (DLB). Moreover, LRP10 variants have been found in individuals diagnosed with progressive supranuclear palsy and amyotrophic lateral sclerosis. Despite this genetic evidence, little is known about the expression and function of LRP10 protein in the human brain under physiological or pathological conditions. To better understand how LRP10 variants lead to neurodegeneration, we first performed an in-depth characterisation of LRP10 expression in post-mortem brains and human-induced pluripotent stem cell (iPSC)-derived astrocytes and neurons from control subjects. In adult human brain, LRP10 is mainly expressed in astrocytes and neurovasculature but undetectable in neurons. Similarly, LRP10 is highly expressed in iPSC-derived astrocytes but cannot be observed in iPSC-derived neurons. In astrocytes, LRP10 is present at trans-Golgi network, plasma membrane, retromer, and early endosomes. Interestingly, LRP10 also partially co-localises and interacts with sortilin-related receptor 1 (SORL1). Furthermore, although LRP10 expression and localisation in the substantia nigra of most idiopathic PD and DLB patients and LRP10 variant carriers diagnosed with PD or DLB appeared unchanged compared to control subjects, significantly enlarged LRP10-positive vesicles were detected in a patient carrying the LRP10 p.Arg235Cys variant. Last, LRP10 was detected in Lewy bodies (LB) at late maturation stages in brains from idiopathic PD and DLB patients and in LRP10 variant carriers. In conclusion, high LRP10 expression in non-neuronal cells and undetectable levels in neurons of control subjects indicate that LRP10-mediated pathogenicity is initiated via cell non-autonomous mechanisms, potentially involving the interaction of LRP10 with SORL1 in vesicle trafficking pathways. Together with the specific pattern of LRP10 incorporation into mature LBs, these data support an important mechanistic role for disturbed vesicle trafficking and loss of LRP10 function in neurodegenerative diseases. SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1007/s00401-021-02313-3. Springer Berlin Heidelberg 2021-04-28 2021 /pmc/articles/PMC8217053/ /pubmed/33913039 http://dx.doi.org/10.1007/s00401-021-02313-3 Text en © The Author(s) 2021 https://creativecommons.org/licenses/by/4.0/Open AccessThis article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/ (https://creativecommons.org/licenses/by/4.0/) . |
spellingShingle | Original Paper Grochowska, Martyna M. Carreras Mascaro, Ana Boumeester, Valerie Natale, Domenico Breedveld, Guido J. Geut, Hanneke van Cappellen, Wiggert A. Boon, Agnita J. W. Kievit, Anneke J. A. Sammler, Esther Parchi, Piero Cortelli, Pietro Alessi, Dario R. van de Berg, Wilma D. J. Bonifati, Vincenzo Mandemakers, Wim LRP10 interacts with SORL1 in the intracellular vesicle trafficking pathway in non-neuronal brain cells and localises to Lewy bodies in Parkinson’s disease and dementia with Lewy bodies |
title | LRP10 interacts with SORL1 in the intracellular vesicle trafficking pathway in non-neuronal brain cells and localises to Lewy bodies in Parkinson’s disease and dementia with Lewy bodies |
title_full | LRP10 interacts with SORL1 in the intracellular vesicle trafficking pathway in non-neuronal brain cells and localises to Lewy bodies in Parkinson’s disease and dementia with Lewy bodies |
title_fullStr | LRP10 interacts with SORL1 in the intracellular vesicle trafficking pathway in non-neuronal brain cells and localises to Lewy bodies in Parkinson’s disease and dementia with Lewy bodies |
title_full_unstemmed | LRP10 interacts with SORL1 in the intracellular vesicle trafficking pathway in non-neuronal brain cells and localises to Lewy bodies in Parkinson’s disease and dementia with Lewy bodies |
title_short | LRP10 interacts with SORL1 in the intracellular vesicle trafficking pathway in non-neuronal brain cells and localises to Lewy bodies in Parkinson’s disease and dementia with Lewy bodies |
title_sort | lrp10 interacts with sorl1 in the intracellular vesicle trafficking pathway in non-neuronal brain cells and localises to lewy bodies in parkinson’s disease and dementia with lewy bodies |
topic | Original Paper |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8217053/ https://www.ncbi.nlm.nih.gov/pubmed/33913039 http://dx.doi.org/10.1007/s00401-021-02313-3 |
work_keys_str_mv | AT grochowskamartynam lrp10interactswithsorl1intheintracellularvesicletraffickingpathwayinnonneuronalbraincellsandlocalisestolewybodiesinparkinsonsdiseaseanddementiawithlewybodies AT carrerasmascaroana lrp10interactswithsorl1intheintracellularvesicletraffickingpathwayinnonneuronalbraincellsandlocalisestolewybodiesinparkinsonsdiseaseanddementiawithlewybodies AT boumeestervalerie lrp10interactswithsorl1intheintracellularvesicletraffickingpathwayinnonneuronalbraincellsandlocalisestolewybodiesinparkinsonsdiseaseanddementiawithlewybodies AT nataledomenico lrp10interactswithsorl1intheintracellularvesicletraffickingpathwayinnonneuronalbraincellsandlocalisestolewybodiesinparkinsonsdiseaseanddementiawithlewybodies AT breedveldguidoj lrp10interactswithsorl1intheintracellularvesicletraffickingpathwayinnonneuronalbraincellsandlocalisestolewybodiesinparkinsonsdiseaseanddementiawithlewybodies AT geuthanneke lrp10interactswithsorl1intheintracellularvesicletraffickingpathwayinnonneuronalbraincellsandlocalisestolewybodiesinparkinsonsdiseaseanddementiawithlewybodies AT vancappellenwiggerta lrp10interactswithsorl1intheintracellularvesicletraffickingpathwayinnonneuronalbraincellsandlocalisestolewybodiesinparkinsonsdiseaseanddementiawithlewybodies AT boonagnitajw lrp10interactswithsorl1intheintracellularvesicletraffickingpathwayinnonneuronalbraincellsandlocalisestolewybodiesinparkinsonsdiseaseanddementiawithlewybodies AT kievitannekeja lrp10interactswithsorl1intheintracellularvesicletraffickingpathwayinnonneuronalbraincellsandlocalisestolewybodiesinparkinsonsdiseaseanddementiawithlewybodies AT sammleresther lrp10interactswithsorl1intheintracellularvesicletraffickingpathwayinnonneuronalbraincellsandlocalisestolewybodiesinparkinsonsdiseaseanddementiawithlewybodies AT lrp10interactswithsorl1intheintracellularvesicletraffickingpathwayinnonneuronalbraincellsandlocalisestolewybodiesinparkinsonsdiseaseanddementiawithlewybodies AT parchipiero lrp10interactswithsorl1intheintracellularvesicletraffickingpathwayinnonneuronalbraincellsandlocalisestolewybodiesinparkinsonsdiseaseanddementiawithlewybodies AT cortellipietro lrp10interactswithsorl1intheintracellularvesicletraffickingpathwayinnonneuronalbraincellsandlocalisestolewybodiesinparkinsonsdiseaseanddementiawithlewybodies AT alessidarior lrp10interactswithsorl1intheintracellularvesicletraffickingpathwayinnonneuronalbraincellsandlocalisestolewybodiesinparkinsonsdiseaseanddementiawithlewybodies AT vandebergwilmadj lrp10interactswithsorl1intheintracellularvesicletraffickingpathwayinnonneuronalbraincellsandlocalisestolewybodiesinparkinsonsdiseaseanddementiawithlewybodies AT bonifativincenzo lrp10interactswithsorl1intheintracellularvesicletraffickingpathwayinnonneuronalbraincellsandlocalisestolewybodiesinparkinsonsdiseaseanddementiawithlewybodies AT mandemakerswim lrp10interactswithsorl1intheintracellularvesicletraffickingpathwayinnonneuronalbraincellsandlocalisestolewybodiesinparkinsonsdiseaseanddementiawithlewybodies |