Cargando…

A complete chloroplast genome of Keteleeria davidiana (Pinaceae) and its phylogenetic implications

Keteleeria davidiana (Bertrand) Beissner 1891 (Pinaceae) is a rare tertiary relict plant endemic to China. However, since the main morphological characteristics used for identifying K. davidiana are variable, some taxonomic treatments within the species are still controversial. Here a complete chlor...

Descripción completa

Detalles Bibliográficos
Autores principales: Zhang, Min, Li, Yuan-Yuan, Chai, Zi-Han, Zhu, Yue, Duan, Yi-Fan
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Taylor & Francis 2021
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8218866/
https://www.ncbi.nlm.nih.gov/pubmed/34212102
http://dx.doi.org/10.1080/23802359.2021.1907253
_version_ 1783710827368415232
author Zhang, Min
Li, Yuan-Yuan
Chai, Zi-Han
Zhu, Yue
Duan, Yi-Fan
author_facet Zhang, Min
Li, Yuan-Yuan
Chai, Zi-Han
Zhu, Yue
Duan, Yi-Fan
author_sort Zhang, Min
collection PubMed
description Keteleeria davidiana (Bertrand) Beissner 1891 (Pinaceae) is a rare tertiary relict plant endemic to China. However, since the main morphological characteristics used for identifying K. davidiana are variable, some taxonomic treatments within the species are still controversial. Here a complete chloroplast genome of K. davidiana representing a special genotype was assembled, which could provide more information for the taxonomic study of this species. The assembled genome was 117,642 bp in length with a large single-copy (LSC) region (74,825 bp), a small single-copy (SSC) region (40,247 bp), and two incomplete inverted repeats (IRs) regions (1285 bp each). In total, 118 genes were predicted, including 4 rRNAs, 34 tRNAs, and 80 protein-coding genes. The overall GC content of the assembled genome was 38.5%. Phylogenetic analysis showed that different accessions of K. davidiana formed a clade with relatively low support (bootstrap value = 71), which indicated a high level of sequences variation within the species.
format Online
Article
Text
id pubmed-8218866
institution National Center for Biotechnology Information
language English
publishDate 2021
publisher Taylor & Francis
record_format MEDLINE/PubMed
spelling pubmed-82188662021-06-30 A complete chloroplast genome of Keteleeria davidiana (Pinaceae) and its phylogenetic implications Zhang, Min Li, Yuan-Yuan Chai, Zi-Han Zhu, Yue Duan, Yi-Fan Mitochondrial DNA B Resour Mitogenome Announcement Keteleeria davidiana (Bertrand) Beissner 1891 (Pinaceae) is a rare tertiary relict plant endemic to China. However, since the main morphological characteristics used for identifying K. davidiana are variable, some taxonomic treatments within the species are still controversial. Here a complete chloroplast genome of K. davidiana representing a special genotype was assembled, which could provide more information for the taxonomic study of this species. The assembled genome was 117,642 bp in length with a large single-copy (LSC) region (74,825 bp), a small single-copy (SSC) region (40,247 bp), and two incomplete inverted repeats (IRs) regions (1285 bp each). In total, 118 genes were predicted, including 4 rRNAs, 34 tRNAs, and 80 protein-coding genes. The overall GC content of the assembled genome was 38.5%. Phylogenetic analysis showed that different accessions of K. davidiana formed a clade with relatively low support (bootstrap value = 71), which indicated a high level of sequences variation within the species. Taylor & Francis 2021-06-21 /pmc/articles/PMC8218866/ /pubmed/34212102 http://dx.doi.org/10.1080/23802359.2021.1907253 Text en © 2021 The Author(s). Published by Informa UK Limited, trading as Taylor & Francis Group. https://creativecommons.org/licenses/by/4.0/This is an Open Access article distributed under the terms of the Creative Commons Attribution License (http://creativecommons.org/licenses/by/4.0/ (https://creativecommons.org/licenses/by/4.0/) ), which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited.
spellingShingle Mitogenome Announcement
Zhang, Min
Li, Yuan-Yuan
Chai, Zi-Han
Zhu, Yue
Duan, Yi-Fan
A complete chloroplast genome of Keteleeria davidiana (Pinaceae) and its phylogenetic implications
title A complete chloroplast genome of Keteleeria davidiana (Pinaceae) and its phylogenetic implications
title_full A complete chloroplast genome of Keteleeria davidiana (Pinaceae) and its phylogenetic implications
title_fullStr A complete chloroplast genome of Keteleeria davidiana (Pinaceae) and its phylogenetic implications
title_full_unstemmed A complete chloroplast genome of Keteleeria davidiana (Pinaceae) and its phylogenetic implications
title_short A complete chloroplast genome of Keteleeria davidiana (Pinaceae) and its phylogenetic implications
title_sort complete chloroplast genome of keteleeria davidiana (pinaceae) and its phylogenetic implications
topic Mitogenome Announcement
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8218866/
https://www.ncbi.nlm.nih.gov/pubmed/34212102
http://dx.doi.org/10.1080/23802359.2021.1907253
work_keys_str_mv AT zhangmin acompletechloroplastgenomeofketeleeriadavidianapinaceaeanditsphylogeneticimplications
AT liyuanyuan acompletechloroplastgenomeofketeleeriadavidianapinaceaeanditsphylogeneticimplications
AT chaizihan acompletechloroplastgenomeofketeleeriadavidianapinaceaeanditsphylogeneticimplications
AT zhuyue acompletechloroplastgenomeofketeleeriadavidianapinaceaeanditsphylogeneticimplications
AT duanyifan acompletechloroplastgenomeofketeleeriadavidianapinaceaeanditsphylogeneticimplications
AT zhangmin completechloroplastgenomeofketeleeriadavidianapinaceaeanditsphylogeneticimplications
AT liyuanyuan completechloroplastgenomeofketeleeriadavidianapinaceaeanditsphylogeneticimplications
AT chaizihan completechloroplastgenomeofketeleeriadavidianapinaceaeanditsphylogeneticimplications
AT zhuyue completechloroplastgenomeofketeleeriadavidianapinaceaeanditsphylogeneticimplications
AT duanyifan completechloroplastgenomeofketeleeriadavidianapinaceaeanditsphylogeneticimplications