Cargando…
A complete chloroplast genome of Keteleeria davidiana (Pinaceae) and its phylogenetic implications
Keteleeria davidiana (Bertrand) Beissner 1891 (Pinaceae) is a rare tertiary relict plant endemic to China. However, since the main morphological characteristics used for identifying K. davidiana are variable, some taxonomic treatments within the species are still controversial. Here a complete chlor...
Autores principales: | , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Taylor & Francis
2021
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8218866/ https://www.ncbi.nlm.nih.gov/pubmed/34212102 http://dx.doi.org/10.1080/23802359.2021.1907253 |
_version_ | 1783710827368415232 |
---|---|
author | Zhang, Min Li, Yuan-Yuan Chai, Zi-Han Zhu, Yue Duan, Yi-Fan |
author_facet | Zhang, Min Li, Yuan-Yuan Chai, Zi-Han Zhu, Yue Duan, Yi-Fan |
author_sort | Zhang, Min |
collection | PubMed |
description | Keteleeria davidiana (Bertrand) Beissner 1891 (Pinaceae) is a rare tertiary relict plant endemic to China. However, since the main morphological characteristics used for identifying K. davidiana are variable, some taxonomic treatments within the species are still controversial. Here a complete chloroplast genome of K. davidiana representing a special genotype was assembled, which could provide more information for the taxonomic study of this species. The assembled genome was 117,642 bp in length with a large single-copy (LSC) region (74,825 bp), a small single-copy (SSC) region (40,247 bp), and two incomplete inverted repeats (IRs) regions (1285 bp each). In total, 118 genes were predicted, including 4 rRNAs, 34 tRNAs, and 80 protein-coding genes. The overall GC content of the assembled genome was 38.5%. Phylogenetic analysis showed that different accessions of K. davidiana formed a clade with relatively low support (bootstrap value = 71), which indicated a high level of sequences variation within the species. |
format | Online Article Text |
id | pubmed-8218866 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2021 |
publisher | Taylor & Francis |
record_format | MEDLINE/PubMed |
spelling | pubmed-82188662021-06-30 A complete chloroplast genome of Keteleeria davidiana (Pinaceae) and its phylogenetic implications Zhang, Min Li, Yuan-Yuan Chai, Zi-Han Zhu, Yue Duan, Yi-Fan Mitochondrial DNA B Resour Mitogenome Announcement Keteleeria davidiana (Bertrand) Beissner 1891 (Pinaceae) is a rare tertiary relict plant endemic to China. However, since the main morphological characteristics used for identifying K. davidiana are variable, some taxonomic treatments within the species are still controversial. Here a complete chloroplast genome of K. davidiana representing a special genotype was assembled, which could provide more information for the taxonomic study of this species. The assembled genome was 117,642 bp in length with a large single-copy (LSC) region (74,825 bp), a small single-copy (SSC) region (40,247 bp), and two incomplete inverted repeats (IRs) regions (1285 bp each). In total, 118 genes were predicted, including 4 rRNAs, 34 tRNAs, and 80 protein-coding genes. The overall GC content of the assembled genome was 38.5%. Phylogenetic analysis showed that different accessions of K. davidiana formed a clade with relatively low support (bootstrap value = 71), which indicated a high level of sequences variation within the species. Taylor & Francis 2021-06-21 /pmc/articles/PMC8218866/ /pubmed/34212102 http://dx.doi.org/10.1080/23802359.2021.1907253 Text en © 2021 The Author(s). Published by Informa UK Limited, trading as Taylor & Francis Group. https://creativecommons.org/licenses/by/4.0/This is an Open Access article distributed under the terms of the Creative Commons Attribution License (http://creativecommons.org/licenses/by/4.0/ (https://creativecommons.org/licenses/by/4.0/) ), which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited. |
spellingShingle | Mitogenome Announcement Zhang, Min Li, Yuan-Yuan Chai, Zi-Han Zhu, Yue Duan, Yi-Fan A complete chloroplast genome of Keteleeria davidiana (Pinaceae) and its phylogenetic implications |
title | A complete chloroplast genome of Keteleeria davidiana (Pinaceae) and its phylogenetic implications |
title_full | A complete chloroplast genome of Keteleeria davidiana (Pinaceae) and its phylogenetic implications |
title_fullStr | A complete chloroplast genome of Keteleeria davidiana (Pinaceae) and its phylogenetic implications |
title_full_unstemmed | A complete chloroplast genome of Keteleeria davidiana (Pinaceae) and its phylogenetic implications |
title_short | A complete chloroplast genome of Keteleeria davidiana (Pinaceae) and its phylogenetic implications |
title_sort | complete chloroplast genome of keteleeria davidiana (pinaceae) and its phylogenetic implications |
topic | Mitogenome Announcement |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8218866/ https://www.ncbi.nlm.nih.gov/pubmed/34212102 http://dx.doi.org/10.1080/23802359.2021.1907253 |
work_keys_str_mv | AT zhangmin acompletechloroplastgenomeofketeleeriadavidianapinaceaeanditsphylogeneticimplications AT liyuanyuan acompletechloroplastgenomeofketeleeriadavidianapinaceaeanditsphylogeneticimplications AT chaizihan acompletechloroplastgenomeofketeleeriadavidianapinaceaeanditsphylogeneticimplications AT zhuyue acompletechloroplastgenomeofketeleeriadavidianapinaceaeanditsphylogeneticimplications AT duanyifan acompletechloroplastgenomeofketeleeriadavidianapinaceaeanditsphylogeneticimplications AT zhangmin completechloroplastgenomeofketeleeriadavidianapinaceaeanditsphylogeneticimplications AT liyuanyuan completechloroplastgenomeofketeleeriadavidianapinaceaeanditsphylogeneticimplications AT chaizihan completechloroplastgenomeofketeleeriadavidianapinaceaeanditsphylogeneticimplications AT zhuyue completechloroplastgenomeofketeleeriadavidianapinaceaeanditsphylogeneticimplications AT duanyifan completechloroplastgenomeofketeleeriadavidianapinaceaeanditsphylogeneticimplications |