Cargando…

Exploring Sustainability in the Era of Differentiated HIV Service Delivery in Sub-Saharan Africa: A Systematic Review

INTRODUCTION: The World Health Organization recommends differentiated service delivery (DSD) to support resource-limited health systems in providing patient-centered HIV care. DSD offers alternative care models to clinic-based care for people living with HIV who are stable on antiretroviral therapy...

Descripción completa

Detalles Bibliográficos
Autores principales: Okere, Nwanneka E., Lennox, Laura, Urlings, Lisa, Ford, Nathan, Naniche, Denise, Rinke de Wit, Tobias F., Hermans, Sabine, Gomez, Gabriela B.
Formato: Online Artículo Texto
Lenguaje:English
Publicado: JAIDS Journal of Acquired Immune Deficiency Syndromes 2021
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8219088/
https://www.ncbi.nlm.nih.gov/pubmed/33770063
http://dx.doi.org/10.1097/QAI.0000000000002688
_version_ 1783710860181504000
author Okere, Nwanneka E.
Lennox, Laura
Urlings, Lisa
Ford, Nathan
Naniche, Denise
Rinke de Wit, Tobias F.
Hermans, Sabine
Gomez, Gabriela B.
author_facet Okere, Nwanneka E.
Lennox, Laura
Urlings, Lisa
Ford, Nathan
Naniche, Denise
Rinke de Wit, Tobias F.
Hermans, Sabine
Gomez, Gabriela B.
author_sort Okere, Nwanneka E.
collection PubMed
description INTRODUCTION: The World Health Organization recommends differentiated service delivery (DSD) to support resource-limited health systems in providing patient-centered HIV care. DSD offers alternative care models to clinic-based care for people living with HIV who are stable on antiretroviral therapy (ART). Despite good patient-related outcomes, there is limited evidence of their sustainability. Our review evaluated the reporting of sustainability indicators of DSD interventions conducted in sub-Saharan Africa (SSA). METHODS: We searched PubMed and EMBASE for studies conducted between 2000 and 2019 assessing DSD interventions targeting HIV-positive individuals who are established in ART in sub-Saharan Africa. We evaluated them through a comprehensive sustainability framework of constructs categorized into 6 domains (intervention design, process, external environment, resources, organizational setting, and people involvement). We scored each construct 1, 2, or 3 for no, partial, or sufficient level of evidence, respectively. Interventions with a calculated sustainability score (overall and domain-specific) of >90% or domain-specific median score >2.7 were considered likely to be sustainable. RESULTS: Overall scores ranged from 69% to 98%. Top scoring intervention types included adherence clubs (98%) and community ART groups (95%) which comprised more than half of interventions. The highest scoring domains were design (2.9) and organizational setting (2.8). The domains of resources (2.4) and people involvement (2.3) scored lowest revealing potential areas for improvement to support DSD sustainability. CONCLUSIONS: With the right investment in stakeholder involvement and domestic funding, DSD models generally show potential for sustainability. Our results could guide informed decisions on which DSD intervention is likely to be sustainable per setting and highlight areas that could motivate further research.
format Online
Article
Text
id pubmed-8219088
institution National Center for Biotechnology Information
language English
publishDate 2021
publisher JAIDS Journal of Acquired Immune Deficiency Syndromes
record_format MEDLINE/PubMed
spelling pubmed-82190882021-06-24 Exploring Sustainability in the Era of Differentiated HIV Service Delivery in Sub-Saharan Africa: A Systematic Review Okere, Nwanneka E. Lennox, Laura Urlings, Lisa Ford, Nathan Naniche, Denise Rinke de Wit, Tobias F. Hermans, Sabine Gomez, Gabriela B. J Acquir Immune Defic Syndr Implementation Science INTRODUCTION: The World Health Organization recommends differentiated service delivery (DSD) to support resource-limited health systems in providing patient-centered HIV care. DSD offers alternative care models to clinic-based care for people living with HIV who are stable on antiretroviral therapy (ART). Despite good patient-related outcomes, there is limited evidence of their sustainability. Our review evaluated the reporting of sustainability indicators of DSD interventions conducted in sub-Saharan Africa (SSA). METHODS: We searched PubMed and EMBASE for studies conducted between 2000 and 2019 assessing DSD interventions targeting HIV-positive individuals who are established in ART in sub-Saharan Africa. We evaluated them through a comprehensive sustainability framework of constructs categorized into 6 domains (intervention design, process, external environment, resources, organizational setting, and people involvement). We scored each construct 1, 2, or 3 for no, partial, or sufficient level of evidence, respectively. Interventions with a calculated sustainability score (overall and domain-specific) of >90% or domain-specific median score >2.7 were considered likely to be sustainable. RESULTS: Overall scores ranged from 69% to 98%. Top scoring intervention types included adherence clubs (98%) and community ART groups (95%) which comprised more than half of interventions. The highest scoring domains were design (2.9) and organizational setting (2.8). The domains of resources (2.4) and people involvement (2.3) scored lowest revealing potential areas for improvement to support DSD sustainability. CONCLUSIONS: With the right investment in stakeholder involvement and domestic funding, DSD models generally show potential for sustainability. Our results could guide informed decisions on which DSD intervention is likely to be sustainable per setting and highlight areas that could motivate further research. JAIDS Journal of Acquired Immune Deficiency Syndromes 2021-08-01 2021-03-29 /pmc/articles/PMC8219088/ /pubmed/33770063 http://dx.doi.org/10.1097/QAI.0000000000002688 Text en Copyright © 2021 The Author(s). Published by Wolters Kluwer Health, Inc. https://creativecommons.org/licenses/by-nc-nd/4.0/This is an open-access article distributed under the terms of the Creative Commons Attribution-Non Commercial-No Derivatives License 4.0 (CCBY-NC-ND) (https://creativecommons.org/licenses/by-nc-nd/4.0/) , where it is permissible to download and share the work provided it is properly cited. The work cannot be changed in any way or used commercially without permission from the journal.
spellingShingle Implementation Science
Okere, Nwanneka E.
Lennox, Laura
Urlings, Lisa
Ford, Nathan
Naniche, Denise
Rinke de Wit, Tobias F.
Hermans, Sabine
Gomez, Gabriela B.
Exploring Sustainability in the Era of Differentiated HIV Service Delivery in Sub-Saharan Africa: A Systematic Review
title Exploring Sustainability in the Era of Differentiated HIV Service Delivery in Sub-Saharan Africa: A Systematic Review
title_full Exploring Sustainability in the Era of Differentiated HIV Service Delivery in Sub-Saharan Africa: A Systematic Review
title_fullStr Exploring Sustainability in the Era of Differentiated HIV Service Delivery in Sub-Saharan Africa: A Systematic Review
title_full_unstemmed Exploring Sustainability in the Era of Differentiated HIV Service Delivery in Sub-Saharan Africa: A Systematic Review
title_short Exploring Sustainability in the Era of Differentiated HIV Service Delivery in Sub-Saharan Africa: A Systematic Review
title_sort exploring sustainability in the era of differentiated hiv service delivery in sub-saharan africa: a systematic review
topic Implementation Science
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8219088/
https://www.ncbi.nlm.nih.gov/pubmed/33770063
http://dx.doi.org/10.1097/QAI.0000000000002688
work_keys_str_mv AT okerenwannekae exploringsustainabilityintheeraofdifferentiatedhivservicedeliveryinsubsaharanafricaasystematicreview
AT lennoxlaura exploringsustainabilityintheeraofdifferentiatedhivservicedeliveryinsubsaharanafricaasystematicreview
AT urlingslisa exploringsustainabilityintheeraofdifferentiatedhivservicedeliveryinsubsaharanafricaasystematicreview
AT fordnathan exploringsustainabilityintheeraofdifferentiatedhivservicedeliveryinsubsaharanafricaasystematicreview
AT nanichedenise exploringsustainabilityintheeraofdifferentiatedhivservicedeliveryinsubsaharanafricaasystematicreview
AT rinkedewittobiasf exploringsustainabilityintheeraofdifferentiatedhivservicedeliveryinsubsaharanafricaasystematicreview
AT hermanssabine exploringsustainabilityintheeraofdifferentiatedhivservicedeliveryinsubsaharanafricaasystematicreview
AT gomezgabrielab exploringsustainabilityintheeraofdifferentiatedhivservicedeliveryinsubsaharanafricaasystematicreview