Cargando…

MAPK/ERK Signaling Pathway in Hepatocellular Carcinoma

SIMPLE SUMMARY: The mitogen-activated protein kinase/extracellular signal-regulated kinase (MAPK/ERK) signaling pathway is frequently activated in liver cancer, which is one of the most lethal cancers in humans. In addition to genetic mutation leading to persistent activation of effector molecules i...

Descripción completa

Detalles Bibliográficos
Autores principales: Moon, Hyuk, Ro, Simon Weonsang
Formato: Online Artículo Texto
Lenguaje:English
Publicado: MDPI 2021
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8234271/
https://www.ncbi.nlm.nih.gov/pubmed/34204242
http://dx.doi.org/10.3390/cancers13123026
_version_ 1783714045318135808
author Moon, Hyuk
Ro, Simon Weonsang
author_facet Moon, Hyuk
Ro, Simon Weonsang
author_sort Moon, Hyuk
collection PubMed
description SIMPLE SUMMARY: The mitogen-activated protein kinase/extracellular signal-regulated kinase (MAPK/ERK) signaling pathway is frequently activated in liver cancer, which is one of the most lethal cancers in humans. In addition to genetic mutation leading to persistent activation of effector molecules in the MAPK/ERK signaling cascade, there are alternative means by which the MAPK/ERK signaling pathway is activated in cancer. In this review, we will introduce the diverse modulators regulating the MAPK/ERK signaling pathway and consider the possibility of targeting the effectors and regulators in order to suppress the pro-tumorigenic MAPK/ERK signaling pathway, especially in liver cancer. ABSTRACT: Hepatocellular carcinoma (HCC) is a major health concern worldwide, and its incidence is increasing steadily. Recently, the MAPK/ERK signaling pathway in HCC has gained renewed attention from basic and clinical researchers. The MAPK/ERK signaling pathway is activated in more than 50% of human HCC cases; however, activating mutations in RAS and RAF genes are rarely found in HCC, which are major genetic events leading to the activation of the MAPK/ERK signaling pathway in other cancers. This suggests that there is an alternative mechanism behind the activation of the signaling pathway in HCC. Here, we will review recent advances in understanding the cellular and molecular mechanisms involved in the activation of the MAPK/ERK signaling pathway and discuss potential therapeutic strategies targeting the signaling pathway in the context of HCC.
format Online
Article
Text
id pubmed-8234271
institution National Center for Biotechnology Information
language English
publishDate 2021
publisher MDPI
record_format MEDLINE/PubMed
spelling pubmed-82342712021-06-27 MAPK/ERK Signaling Pathway in Hepatocellular Carcinoma Moon, Hyuk Ro, Simon Weonsang Cancers (Basel) Review SIMPLE SUMMARY: The mitogen-activated protein kinase/extracellular signal-regulated kinase (MAPK/ERK) signaling pathway is frequently activated in liver cancer, which is one of the most lethal cancers in humans. In addition to genetic mutation leading to persistent activation of effector molecules in the MAPK/ERK signaling cascade, there are alternative means by which the MAPK/ERK signaling pathway is activated in cancer. In this review, we will introduce the diverse modulators regulating the MAPK/ERK signaling pathway and consider the possibility of targeting the effectors and regulators in order to suppress the pro-tumorigenic MAPK/ERK signaling pathway, especially in liver cancer. ABSTRACT: Hepatocellular carcinoma (HCC) is a major health concern worldwide, and its incidence is increasing steadily. Recently, the MAPK/ERK signaling pathway in HCC has gained renewed attention from basic and clinical researchers. The MAPK/ERK signaling pathway is activated in more than 50% of human HCC cases; however, activating mutations in RAS and RAF genes are rarely found in HCC, which are major genetic events leading to the activation of the MAPK/ERK signaling pathway in other cancers. This suggests that there is an alternative mechanism behind the activation of the signaling pathway in HCC. Here, we will review recent advances in understanding the cellular and molecular mechanisms involved in the activation of the MAPK/ERK signaling pathway and discuss potential therapeutic strategies targeting the signaling pathway in the context of HCC. MDPI 2021-06-17 /pmc/articles/PMC8234271/ /pubmed/34204242 http://dx.doi.org/10.3390/cancers13123026 Text en © 2021 by the authors. https://creativecommons.org/licenses/by/4.0/Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/).
spellingShingle Review
Moon, Hyuk
Ro, Simon Weonsang
MAPK/ERK Signaling Pathway in Hepatocellular Carcinoma
title MAPK/ERK Signaling Pathway in Hepatocellular Carcinoma
title_full MAPK/ERK Signaling Pathway in Hepatocellular Carcinoma
title_fullStr MAPK/ERK Signaling Pathway in Hepatocellular Carcinoma
title_full_unstemmed MAPK/ERK Signaling Pathway in Hepatocellular Carcinoma
title_short MAPK/ERK Signaling Pathway in Hepatocellular Carcinoma
title_sort mapk/erk signaling pathway in hepatocellular carcinoma
topic Review
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8234271/
https://www.ncbi.nlm.nih.gov/pubmed/34204242
http://dx.doi.org/10.3390/cancers13123026
work_keys_str_mv AT moonhyuk mapkerksignalingpathwayinhepatocellularcarcinoma
AT rosimonweonsang mapkerksignalingpathwayinhepatocellularcarcinoma