Cargando…

Factors influencing access to and utilisation of youth-friendly sexual and reproductive health services in sub-Saharan Africa: a systematic review

BACKGROUND: Despite the global agreements on adolescents’ sexual and reproductive health and rights, access to and utilisation of these services among the youth/adolescents remain unsatisfactory in low- and middle-income countries which are a significant barrier to progress in this area. This review...

Descripción completa

Detalles Bibliográficos
Autores principales: Ninsiima, Lesley Rose, Chiumia, Isabel Kazanga, Ndejjo, Rawlance
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2021
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8237506/
https://www.ncbi.nlm.nih.gov/pubmed/34176511
http://dx.doi.org/10.1186/s12978-021-01183-y
_version_ 1783714742259417088
author Ninsiima, Lesley Rose
Chiumia, Isabel Kazanga
Ndejjo, Rawlance
author_facet Ninsiima, Lesley Rose
Chiumia, Isabel Kazanga
Ndejjo, Rawlance
author_sort Ninsiima, Lesley Rose
collection PubMed
description BACKGROUND: Despite the global agreements on adolescents’ sexual and reproductive health and rights, access to and utilisation of these services among the youth/adolescents remain unsatisfactory in low- and middle-income countries which are a significant barrier to progress in this area. This review established factors influencing access and utilisation of youth-friendly sexual and reproductive health services (YFSRHS) among the youth in sub-Saharan Africa to inform programmatic interventions. METHODOLOGY: A systematic review of studies published between January 2009 and April 2019 using PubMed, Web of Science, EMBASE, Medline, and Cochrane Library, and Google Scholar databases was conducted. Studies were screened based on the inclusion criteria of barriers and facilitators of implementation of YFSRHS, existing national policies on provision of YFSRHS, and youth’s perspectives on these services. FINDINGS: A total of 23,400 studies were identified through database search and additional 5 studies from other sources. After the full-text screening, 20 studies from 7 countries met the inclusion criteria and were included in the final review. Structural barriers were the negative attitude of health workers and their being unskilled and individual barriers included lack of knowledge among youth regarding YFSRHS. Facilitators of utilisation of the services were mostly structural in nature which included community outreaches, health education, and policy recommendations to improve implementation of the quality of health services and clinics for adolescents/youth to fit their needs and preferences. CONCLUSION: Stakeholder interventions focusing on implementing YFSRHS should aim at intensive training of health workers and put in place quality implementation standard guidelines in clinics to offer services according to youth’s needs and preferences. In addition, educating the youth through community outreaches and health education programs for those in schools can facilitate utilisation and scale up of the service. SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1186/s12978-021-01183-y.
format Online
Article
Text
id pubmed-8237506
institution National Center for Biotechnology Information
language English
publishDate 2021
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-82375062021-06-29 Factors influencing access to and utilisation of youth-friendly sexual and reproductive health services in sub-Saharan Africa: a systematic review Ninsiima, Lesley Rose Chiumia, Isabel Kazanga Ndejjo, Rawlance Reprod Health Review BACKGROUND: Despite the global agreements on adolescents’ sexual and reproductive health and rights, access to and utilisation of these services among the youth/adolescents remain unsatisfactory in low- and middle-income countries which are a significant barrier to progress in this area. This review established factors influencing access and utilisation of youth-friendly sexual and reproductive health services (YFSRHS) among the youth in sub-Saharan Africa to inform programmatic interventions. METHODOLOGY: A systematic review of studies published between January 2009 and April 2019 using PubMed, Web of Science, EMBASE, Medline, and Cochrane Library, and Google Scholar databases was conducted. Studies were screened based on the inclusion criteria of barriers and facilitators of implementation of YFSRHS, existing national policies on provision of YFSRHS, and youth’s perspectives on these services. FINDINGS: A total of 23,400 studies were identified through database search and additional 5 studies from other sources. After the full-text screening, 20 studies from 7 countries met the inclusion criteria and were included in the final review. Structural barriers were the negative attitude of health workers and their being unskilled and individual barriers included lack of knowledge among youth regarding YFSRHS. Facilitators of utilisation of the services were mostly structural in nature which included community outreaches, health education, and policy recommendations to improve implementation of the quality of health services and clinics for adolescents/youth to fit their needs and preferences. CONCLUSION: Stakeholder interventions focusing on implementing YFSRHS should aim at intensive training of health workers and put in place quality implementation standard guidelines in clinics to offer services according to youth’s needs and preferences. In addition, educating the youth through community outreaches and health education programs for those in schools can facilitate utilisation and scale up of the service. SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1186/s12978-021-01183-y. BioMed Central 2021-06-27 /pmc/articles/PMC8237506/ /pubmed/34176511 http://dx.doi.org/10.1186/s12978-021-01183-y Text en © The Author(s) 2021 https://creativecommons.org/licenses/by/4.0/Open AccessThis article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/ (https://creativecommons.org/licenses/by/4.0/) . The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/ (https://creativecommons.org/publicdomain/zero/1.0/) ) applies to the data made available in this article, unless otherwise stated in a credit line to the data.
spellingShingle Review
Ninsiima, Lesley Rose
Chiumia, Isabel Kazanga
Ndejjo, Rawlance
Factors influencing access to and utilisation of youth-friendly sexual and reproductive health services in sub-Saharan Africa: a systematic review
title Factors influencing access to and utilisation of youth-friendly sexual and reproductive health services in sub-Saharan Africa: a systematic review
title_full Factors influencing access to and utilisation of youth-friendly sexual and reproductive health services in sub-Saharan Africa: a systematic review
title_fullStr Factors influencing access to and utilisation of youth-friendly sexual and reproductive health services in sub-Saharan Africa: a systematic review
title_full_unstemmed Factors influencing access to and utilisation of youth-friendly sexual and reproductive health services in sub-Saharan Africa: a systematic review
title_short Factors influencing access to and utilisation of youth-friendly sexual and reproductive health services in sub-Saharan Africa: a systematic review
title_sort factors influencing access to and utilisation of youth-friendly sexual and reproductive health services in sub-saharan africa: a systematic review
topic Review
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8237506/
https://www.ncbi.nlm.nih.gov/pubmed/34176511
http://dx.doi.org/10.1186/s12978-021-01183-y
work_keys_str_mv AT ninsiimalesleyrose factorsinfluencingaccesstoandutilisationofyouthfriendlysexualandreproductivehealthservicesinsubsaharanafricaasystematicreview
AT chiumiaisabelkazanga factorsinfluencingaccesstoandutilisationofyouthfriendlysexualandreproductivehealthservicesinsubsaharanafricaasystematicreview
AT ndejjorawlance factorsinfluencingaccesstoandutilisationofyouthfriendlysexualandreproductivehealthservicesinsubsaharanafricaasystematicreview