Cargando…
Hepatitis B Screening of At-Risk Immigrants Seen at Primary Care Clinics: A Quality Improvement Project
OBJECTIVE: To test an intervention to increase screening for hepatitis B (HBV) in at-risk immigrants in the primary care setting. PATIENTS AND METHODS: From a Mayo Clinic primary care panel, we identified approximately 19,000 immigrant patients from 9 high-risk countries/ethnic groups with intermedi...
Autores principales: | , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Elsevier
2021
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8240161/ https://www.ncbi.nlm.nih.gov/pubmed/34195555 http://dx.doi.org/10.1016/j.mayocpiqo.2021.04.002 |
_version_ | 1783715157978906624 |
---|---|
author | Eneh, Peace N. Mady, Mohamed Schmidt, Mikayla A. Tilahun, Eneyew Hassan, Fatima Njeru, Jane W. Crane, Sarah J. Chaudhry, Rajeev Roberts, Lewis R. |
author_facet | Eneh, Peace N. Mady, Mohamed Schmidt, Mikayla A. Tilahun, Eneyew Hassan, Fatima Njeru, Jane W. Crane, Sarah J. Chaudhry, Rajeev Roberts, Lewis R. |
author_sort | Eneh, Peace N. |
collection | PubMed |
description | OBJECTIVE: To test an intervention to increase screening for hepatitis B (HBV) in at-risk immigrants in the primary care setting. PATIENTS AND METHODS: From a Mayo Clinic primary care panel, we identified approximately 19,000 immigrant patients from 9 high-risk countries/ethnic groups with intermediate or high prevalences of chronic HBV. Eligible patients with no record of prior HBV testing scheduled for primary care visits within the study period spanning October 1, 2017, through October 31, 2018, were identified. During the intervention period, the primary health care professional was notified by email 1 week prior to each primary care visit and encouraged to discuss screening for HBV infection and order screening tests at the appointment. We assessed rates of HBV screening during control and intervention periods. RESULTS: We identified 597 patients in the control period and 212 patients in the intervention period who had not been screened previously for HBV. During the intervention period, 31.4% (58) of the 185 eligible patients were screened for HBV vs 7.2% (43) of the 597 eligible patients in the control period. Thus, the intervention resulted in a 4.3-fold increase in screening (P<.00001). Of the 101 patients screened in the at-risk population, 22 (21.8%) screened positive for prior exposure to HBV (hepatitis B core antibody–positive) and 6 (5.9%) for chronic HBV infection (hepatitis B surface antigen–positive). CONCLUSION: Notifying primary care physicians of the high-risk status of immigrant patients substantially increased screening for HBV. Identifying patients with HBV is important for monitoring disease prevalence, preventing transmission, and initiating treatment and cancer surveillance, allowing earlier recognition and prevention of chronic hepatitis, disease reactivation, cirrhosis, and hepatocellular carcinoma. |
format | Online Article Text |
id | pubmed-8240161 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2021 |
publisher | Elsevier |
record_format | MEDLINE/PubMed |
spelling | pubmed-82401612021-06-29 Hepatitis B Screening of At-Risk Immigrants Seen at Primary Care Clinics: A Quality Improvement Project Eneh, Peace N. Mady, Mohamed Schmidt, Mikayla A. Tilahun, Eneyew Hassan, Fatima Njeru, Jane W. Crane, Sarah J. Chaudhry, Rajeev Roberts, Lewis R. Mayo Clin Proc Innov Qual Outcomes Original Article OBJECTIVE: To test an intervention to increase screening for hepatitis B (HBV) in at-risk immigrants in the primary care setting. PATIENTS AND METHODS: From a Mayo Clinic primary care panel, we identified approximately 19,000 immigrant patients from 9 high-risk countries/ethnic groups with intermediate or high prevalences of chronic HBV. Eligible patients with no record of prior HBV testing scheduled for primary care visits within the study period spanning October 1, 2017, through October 31, 2018, were identified. During the intervention period, the primary health care professional was notified by email 1 week prior to each primary care visit and encouraged to discuss screening for HBV infection and order screening tests at the appointment. We assessed rates of HBV screening during control and intervention periods. RESULTS: We identified 597 patients in the control period and 212 patients in the intervention period who had not been screened previously for HBV. During the intervention period, 31.4% (58) of the 185 eligible patients were screened for HBV vs 7.2% (43) of the 597 eligible patients in the control period. Thus, the intervention resulted in a 4.3-fold increase in screening (P<.00001). Of the 101 patients screened in the at-risk population, 22 (21.8%) screened positive for prior exposure to HBV (hepatitis B core antibody–positive) and 6 (5.9%) for chronic HBV infection (hepatitis B surface antigen–positive). CONCLUSION: Notifying primary care physicians of the high-risk status of immigrant patients substantially increased screening for HBV. Identifying patients with HBV is important for monitoring disease prevalence, preventing transmission, and initiating treatment and cancer surveillance, allowing earlier recognition and prevention of chronic hepatitis, disease reactivation, cirrhosis, and hepatocellular carcinoma. Elsevier 2021-05-27 /pmc/articles/PMC8240161/ /pubmed/34195555 http://dx.doi.org/10.1016/j.mayocpiqo.2021.04.002 Text en © 2021 [Author/Employing Institution] https://creativecommons.org/licenses/by-nc-nd/4.0/This is an open access article under the CC BY-NC-ND license (http://creativecommons.org/licenses/by-nc-nd/4.0/). |
spellingShingle | Original Article Eneh, Peace N. Mady, Mohamed Schmidt, Mikayla A. Tilahun, Eneyew Hassan, Fatima Njeru, Jane W. Crane, Sarah J. Chaudhry, Rajeev Roberts, Lewis R. Hepatitis B Screening of At-Risk Immigrants Seen at Primary Care Clinics: A Quality Improvement Project |
title | Hepatitis B Screening of At-Risk Immigrants Seen at Primary Care Clinics: A Quality Improvement Project |
title_full | Hepatitis B Screening of At-Risk Immigrants Seen at Primary Care Clinics: A Quality Improvement Project |
title_fullStr | Hepatitis B Screening of At-Risk Immigrants Seen at Primary Care Clinics: A Quality Improvement Project |
title_full_unstemmed | Hepatitis B Screening of At-Risk Immigrants Seen at Primary Care Clinics: A Quality Improvement Project |
title_short | Hepatitis B Screening of At-Risk Immigrants Seen at Primary Care Clinics: A Quality Improvement Project |
title_sort | hepatitis b screening of at-risk immigrants seen at primary care clinics: a quality improvement project |
topic | Original Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8240161/ https://www.ncbi.nlm.nih.gov/pubmed/34195555 http://dx.doi.org/10.1016/j.mayocpiqo.2021.04.002 |
work_keys_str_mv | AT enehpeacen hepatitisbscreeningofatriskimmigrantsseenatprimarycareclinicsaqualityimprovementproject AT madymohamed hepatitisbscreeningofatriskimmigrantsseenatprimarycareclinicsaqualityimprovementproject AT schmidtmikaylaa hepatitisbscreeningofatriskimmigrantsseenatprimarycareclinicsaqualityimprovementproject AT tilahuneneyew hepatitisbscreeningofatriskimmigrantsseenatprimarycareclinicsaqualityimprovementproject AT hassanfatima hepatitisbscreeningofatriskimmigrantsseenatprimarycareclinicsaqualityimprovementproject AT njerujanew hepatitisbscreeningofatriskimmigrantsseenatprimarycareclinicsaqualityimprovementproject AT cranesarahj hepatitisbscreeningofatriskimmigrantsseenatprimarycareclinicsaqualityimprovementproject AT chaudhryrajeev hepatitisbscreeningofatriskimmigrantsseenatprimarycareclinicsaqualityimprovementproject AT robertslewisr hepatitisbscreeningofatriskimmigrantsseenatprimarycareclinicsaqualityimprovementproject |