Cargando…

Hepatitis B Screening of At-Risk Immigrants Seen at Primary Care Clinics: A Quality Improvement Project

OBJECTIVE: To test an intervention to increase screening for hepatitis B (HBV) in at-risk immigrants in the primary care setting. PATIENTS AND METHODS: From a Mayo Clinic primary care panel, we identified approximately 19,000 immigrant patients from 9 high-risk countries/ethnic groups with intermedi...

Descripción completa

Detalles Bibliográficos
Autores principales: Eneh, Peace N., Mady, Mohamed, Schmidt, Mikayla A., Tilahun, Eneyew, Hassan, Fatima, Njeru, Jane W., Crane, Sarah J., Chaudhry, Rajeev, Roberts, Lewis R.
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Elsevier 2021
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8240161/
https://www.ncbi.nlm.nih.gov/pubmed/34195555
http://dx.doi.org/10.1016/j.mayocpiqo.2021.04.002
_version_ 1783715157978906624
author Eneh, Peace N.
Mady, Mohamed
Schmidt, Mikayla A.
Tilahun, Eneyew
Hassan, Fatima
Njeru, Jane W.
Crane, Sarah J.
Chaudhry, Rajeev
Roberts, Lewis R.
author_facet Eneh, Peace N.
Mady, Mohamed
Schmidt, Mikayla A.
Tilahun, Eneyew
Hassan, Fatima
Njeru, Jane W.
Crane, Sarah J.
Chaudhry, Rajeev
Roberts, Lewis R.
author_sort Eneh, Peace N.
collection PubMed
description OBJECTIVE: To test an intervention to increase screening for hepatitis B (HBV) in at-risk immigrants in the primary care setting. PATIENTS AND METHODS: From a Mayo Clinic primary care panel, we identified approximately 19,000 immigrant patients from 9 high-risk countries/ethnic groups with intermediate or high prevalences of chronic HBV. Eligible patients with no record of prior HBV testing scheduled for primary care visits within the study period spanning October 1, 2017, through October 31, 2018, were identified. During the intervention period, the primary health care professional was notified by email 1 week prior to each primary care visit and encouraged to discuss screening for HBV infection and order screening tests at the appointment. We assessed rates of HBV screening during control and intervention periods. RESULTS: We identified 597 patients in the control period and 212 patients in the intervention period who had not been screened previously for HBV. During the intervention period, 31.4% (58) of the 185 eligible patients were screened for HBV vs 7.2% (43) of the 597 eligible patients in the control period. Thus, the intervention resulted in a 4.3-fold increase in screening (P<.00001). Of the 101 patients screened in the at-risk population, 22 (21.8%) screened positive for prior exposure to HBV (hepatitis B core antibody–positive) and 6 (5.9%) for chronic HBV infection (hepatitis B surface antigen–positive). CONCLUSION: Notifying primary care physicians of the high-risk status of immigrant patients substantially increased screening for HBV. Identifying patients with HBV is important for monitoring disease prevalence, preventing transmission, and initiating treatment and cancer surveillance, allowing earlier recognition and prevention of chronic hepatitis, disease reactivation, cirrhosis, and hepatocellular carcinoma.
format Online
Article
Text
id pubmed-8240161
institution National Center for Biotechnology Information
language English
publishDate 2021
publisher Elsevier
record_format MEDLINE/PubMed
spelling pubmed-82401612021-06-29 Hepatitis B Screening of At-Risk Immigrants Seen at Primary Care Clinics: A Quality Improvement Project Eneh, Peace N. Mady, Mohamed Schmidt, Mikayla A. Tilahun, Eneyew Hassan, Fatima Njeru, Jane W. Crane, Sarah J. Chaudhry, Rajeev Roberts, Lewis R. Mayo Clin Proc Innov Qual Outcomes Original Article OBJECTIVE: To test an intervention to increase screening for hepatitis B (HBV) in at-risk immigrants in the primary care setting. PATIENTS AND METHODS: From a Mayo Clinic primary care panel, we identified approximately 19,000 immigrant patients from 9 high-risk countries/ethnic groups with intermediate or high prevalences of chronic HBV. Eligible patients with no record of prior HBV testing scheduled for primary care visits within the study period spanning October 1, 2017, through October 31, 2018, were identified. During the intervention period, the primary health care professional was notified by email 1 week prior to each primary care visit and encouraged to discuss screening for HBV infection and order screening tests at the appointment. We assessed rates of HBV screening during control and intervention periods. RESULTS: We identified 597 patients in the control period and 212 patients in the intervention period who had not been screened previously for HBV. During the intervention period, 31.4% (58) of the 185 eligible patients were screened for HBV vs 7.2% (43) of the 597 eligible patients in the control period. Thus, the intervention resulted in a 4.3-fold increase in screening (P<.00001). Of the 101 patients screened in the at-risk population, 22 (21.8%) screened positive for prior exposure to HBV (hepatitis B core antibody–positive) and 6 (5.9%) for chronic HBV infection (hepatitis B surface antigen–positive). CONCLUSION: Notifying primary care physicians of the high-risk status of immigrant patients substantially increased screening for HBV. Identifying patients with HBV is important for monitoring disease prevalence, preventing transmission, and initiating treatment and cancer surveillance, allowing earlier recognition and prevention of chronic hepatitis, disease reactivation, cirrhosis, and hepatocellular carcinoma. Elsevier 2021-05-27 /pmc/articles/PMC8240161/ /pubmed/34195555 http://dx.doi.org/10.1016/j.mayocpiqo.2021.04.002 Text en © 2021 [Author/Employing Institution] https://creativecommons.org/licenses/by-nc-nd/4.0/This is an open access article under the CC BY-NC-ND license (http://creativecommons.org/licenses/by-nc-nd/4.0/).
spellingShingle Original Article
Eneh, Peace N.
Mady, Mohamed
Schmidt, Mikayla A.
Tilahun, Eneyew
Hassan, Fatima
Njeru, Jane W.
Crane, Sarah J.
Chaudhry, Rajeev
Roberts, Lewis R.
Hepatitis B Screening of At-Risk Immigrants Seen at Primary Care Clinics: A Quality Improvement Project
title Hepatitis B Screening of At-Risk Immigrants Seen at Primary Care Clinics: A Quality Improvement Project
title_full Hepatitis B Screening of At-Risk Immigrants Seen at Primary Care Clinics: A Quality Improvement Project
title_fullStr Hepatitis B Screening of At-Risk Immigrants Seen at Primary Care Clinics: A Quality Improvement Project
title_full_unstemmed Hepatitis B Screening of At-Risk Immigrants Seen at Primary Care Clinics: A Quality Improvement Project
title_short Hepatitis B Screening of At-Risk Immigrants Seen at Primary Care Clinics: A Quality Improvement Project
title_sort hepatitis b screening of at-risk immigrants seen at primary care clinics: a quality improvement project
topic Original Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8240161/
https://www.ncbi.nlm.nih.gov/pubmed/34195555
http://dx.doi.org/10.1016/j.mayocpiqo.2021.04.002
work_keys_str_mv AT enehpeacen hepatitisbscreeningofatriskimmigrantsseenatprimarycareclinicsaqualityimprovementproject
AT madymohamed hepatitisbscreeningofatriskimmigrantsseenatprimarycareclinicsaqualityimprovementproject
AT schmidtmikaylaa hepatitisbscreeningofatriskimmigrantsseenatprimarycareclinicsaqualityimprovementproject
AT tilahuneneyew hepatitisbscreeningofatriskimmigrantsseenatprimarycareclinicsaqualityimprovementproject
AT hassanfatima hepatitisbscreeningofatriskimmigrantsseenatprimarycareclinicsaqualityimprovementproject
AT njerujanew hepatitisbscreeningofatriskimmigrantsseenatprimarycareclinicsaqualityimprovementproject
AT cranesarahj hepatitisbscreeningofatriskimmigrantsseenatprimarycareclinicsaqualityimprovementproject
AT chaudhryrajeev hepatitisbscreeningofatriskimmigrantsseenatprimarycareclinicsaqualityimprovementproject
AT robertslewisr hepatitisbscreeningofatriskimmigrantsseenatprimarycareclinicsaqualityimprovementproject