Cargando…

Determinants of intrauterine contraceptive device utilization at primary health care facilities in Mekelle City, northern Ethiopia

BACKGROUND: Each year, the current level of modern contraceptive use averts 188 million unintended pregnancies, which in turn results in 112 million fewer abortions. Of the 867 million women in the developing world who are sexually active and want to avoid becoming pregnant, approximately 222 millio...

Descripción completa

Detalles Bibliográficos
Autores principales: Birgoda, Gebremaryam Temesgen, Gebrehiwot, Haftom, Hebo, Sultan Hussen, Hagos, Birhane, Assefa, Genet, Sidamo, Negussie Boti, Shembri, Mulugeta Shegaze
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2021
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8247089/
https://www.ncbi.nlm.nih.gov/pubmed/34193318
http://dx.doi.org/10.1186/s40834-021-00164-7
_version_ 1783716450304786432
author Birgoda, Gebremaryam Temesgen
Gebrehiwot, Haftom
Hebo, Sultan Hussen
Hagos, Birhane
Assefa, Genet
Sidamo, Negussie Boti
Shembri, Mulugeta Shegaze
author_facet Birgoda, Gebremaryam Temesgen
Gebrehiwot, Haftom
Hebo, Sultan Hussen
Hagos, Birhane
Assefa, Genet
Sidamo, Negussie Boti
Shembri, Mulugeta Shegaze
author_sort Birgoda, Gebremaryam Temesgen
collection PubMed
description BACKGROUND: Each year, the current level of modern contraceptive use averts 188 million unintended pregnancies, which in turn results in 112 million fewer abortions. Of the 867 million women in the developing world who are sexually active and want to avoid becoming pregnant, approximately 222 million of them have an unmet need for modern contraception. In spite of several advantages and potential effectiveness of Intra Uterine Contraceptive Device, its utilization still too low in Sub Saharan African countries including Ethiopia. OBJECTIVES: To identify the determinant factors for utilization of intra uterine contraceptive device among women visiting primary health care facilities in Mekelle city. METHOD: Facility based unmatched case-control study design was conducted among 234 women (78 cases and 156 controls). Data was collected by structured questionnaire. Data entry and cleaning was done using EPI- Info version 5.3.1 and analysis done using SPSS version 20.0 statistical software. During analysis the variables were defined, categorized and the difference in variables was determined. Odds ratio used to show degree of association between independent variables with Intra Uterine Contraceptive Device. RESULT: Marital status ([AOR (95%CI) =8.59(2.60–28.43)], number of pregnancies (AOR (95%) CI = 5.69(1.020–31.802), number of alive children [AOR (95%CI) =3.5 (1.03–11.9) are variables continued to have statistically significant association with use of Intra Uterine Contraceptive Device. Other determinants found to have significant association includes awareness about Intra Uterine Contraceptive Device, visual exposure to Intra Uterine Contraceptive Device, and participants told about availability of health care provider able to insert Intra Uterine Contraceptive Device. CONCLUSION: This study has identified marital status, Gravidity, number of alive children and awareness to Intra Uterine Contraceptive Device as major determinants for use of Intra Uterine Contraceptive Device. Thus, it is vital at addressing the aforementioned determinants will be vital to improve utilization of Intra Uterine Contraceptive Device. PLAIN ENGLISH SUMMARY: Among long acting reversible modern contraceptive methods, Intra Uterine Contraceptive Devices (IUCDs) are the most reliable and effective as well as with fewer side effects. Despite these advantages and cost effective potential of Intra Uterine Contraceptive Device its utilization is still too low in Sub Saharan countries like Ethiopia. Thus, this study intended to identify the factors that limit the utilization of Intra Uterine Contraceptive Device among women of Ethiopia in Mekele City. The study identify that the utilization of Intra Uterine Contraceptive Device was determined by the marital status of the women, the number of previous pregnancy and recent alive children and the level of awareness about Intra Uterine Contraceptive Device of the women. Therefore, providers training that focus on promoting Intra Uterine Contraceptive Device, centering on increasing awareness and practice about Intra Uterine Contraceptive Device is very important.
format Online
Article
Text
id pubmed-8247089
institution National Center for Biotechnology Information
language English
publishDate 2021
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-82470892021-07-06 Determinants of intrauterine contraceptive device utilization at primary health care facilities in Mekelle City, northern Ethiopia Birgoda, Gebremaryam Temesgen Gebrehiwot, Haftom Hebo, Sultan Hussen Hagos, Birhane Assefa, Genet Sidamo, Negussie Boti Shembri, Mulugeta Shegaze Contracept Reprod Med Research BACKGROUND: Each year, the current level of modern contraceptive use averts 188 million unintended pregnancies, which in turn results in 112 million fewer abortions. Of the 867 million women in the developing world who are sexually active and want to avoid becoming pregnant, approximately 222 million of them have an unmet need for modern contraception. In spite of several advantages and potential effectiveness of Intra Uterine Contraceptive Device, its utilization still too low in Sub Saharan African countries including Ethiopia. OBJECTIVES: To identify the determinant factors for utilization of intra uterine contraceptive device among women visiting primary health care facilities in Mekelle city. METHOD: Facility based unmatched case-control study design was conducted among 234 women (78 cases and 156 controls). Data was collected by structured questionnaire. Data entry and cleaning was done using EPI- Info version 5.3.1 and analysis done using SPSS version 20.0 statistical software. During analysis the variables were defined, categorized and the difference in variables was determined. Odds ratio used to show degree of association between independent variables with Intra Uterine Contraceptive Device. RESULT: Marital status ([AOR (95%CI) =8.59(2.60–28.43)], number of pregnancies (AOR (95%) CI = 5.69(1.020–31.802), number of alive children [AOR (95%CI) =3.5 (1.03–11.9) are variables continued to have statistically significant association with use of Intra Uterine Contraceptive Device. Other determinants found to have significant association includes awareness about Intra Uterine Contraceptive Device, visual exposure to Intra Uterine Contraceptive Device, and participants told about availability of health care provider able to insert Intra Uterine Contraceptive Device. CONCLUSION: This study has identified marital status, Gravidity, number of alive children and awareness to Intra Uterine Contraceptive Device as major determinants for use of Intra Uterine Contraceptive Device. Thus, it is vital at addressing the aforementioned determinants will be vital to improve utilization of Intra Uterine Contraceptive Device. PLAIN ENGLISH SUMMARY: Among long acting reversible modern contraceptive methods, Intra Uterine Contraceptive Devices (IUCDs) are the most reliable and effective as well as with fewer side effects. Despite these advantages and cost effective potential of Intra Uterine Contraceptive Device its utilization is still too low in Sub Saharan countries like Ethiopia. Thus, this study intended to identify the factors that limit the utilization of Intra Uterine Contraceptive Device among women of Ethiopia in Mekele City. The study identify that the utilization of Intra Uterine Contraceptive Device was determined by the marital status of the women, the number of previous pregnancy and recent alive children and the level of awareness about Intra Uterine Contraceptive Device of the women. Therefore, providers training that focus on promoting Intra Uterine Contraceptive Device, centering on increasing awareness and practice about Intra Uterine Contraceptive Device is very important. BioMed Central 2021-07-01 /pmc/articles/PMC8247089/ /pubmed/34193318 http://dx.doi.org/10.1186/s40834-021-00164-7 Text en © The Author(s) 2021 https://creativecommons.org/licenses/by/4.0/Open AccessThis article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/ (https://creativecommons.org/licenses/by/4.0/) . The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/ (https://creativecommons.org/publicdomain/zero/1.0/) ) applies to the data made available in this article, unless otherwise stated in a credit line to the data.
spellingShingle Research
Birgoda, Gebremaryam Temesgen
Gebrehiwot, Haftom
Hebo, Sultan Hussen
Hagos, Birhane
Assefa, Genet
Sidamo, Negussie Boti
Shembri, Mulugeta Shegaze
Determinants of intrauterine contraceptive device utilization at primary health care facilities in Mekelle City, northern Ethiopia
title Determinants of intrauterine contraceptive device utilization at primary health care facilities in Mekelle City, northern Ethiopia
title_full Determinants of intrauterine contraceptive device utilization at primary health care facilities in Mekelle City, northern Ethiopia
title_fullStr Determinants of intrauterine contraceptive device utilization at primary health care facilities in Mekelle City, northern Ethiopia
title_full_unstemmed Determinants of intrauterine contraceptive device utilization at primary health care facilities in Mekelle City, northern Ethiopia
title_short Determinants of intrauterine contraceptive device utilization at primary health care facilities in Mekelle City, northern Ethiopia
title_sort determinants of intrauterine contraceptive device utilization at primary health care facilities in mekelle city, northern ethiopia
topic Research
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8247089/
https://www.ncbi.nlm.nih.gov/pubmed/34193318
http://dx.doi.org/10.1186/s40834-021-00164-7
work_keys_str_mv AT birgodagebremaryamtemesgen determinantsofintrauterinecontraceptivedeviceutilizationatprimaryhealthcarefacilitiesinmekellecitynorthernethiopia
AT gebrehiwothaftom determinantsofintrauterinecontraceptivedeviceutilizationatprimaryhealthcarefacilitiesinmekellecitynorthernethiopia
AT hebosultanhussen determinantsofintrauterinecontraceptivedeviceutilizationatprimaryhealthcarefacilitiesinmekellecitynorthernethiopia
AT hagosbirhane determinantsofintrauterinecontraceptivedeviceutilizationatprimaryhealthcarefacilitiesinmekellecitynorthernethiopia
AT assefagenet determinantsofintrauterinecontraceptivedeviceutilizationatprimaryhealthcarefacilitiesinmekellecitynorthernethiopia
AT sidamonegussieboti determinantsofintrauterinecontraceptivedeviceutilizationatprimaryhealthcarefacilitiesinmekellecitynorthernethiopia
AT shembrimulugetashegaze determinantsofintrauterinecontraceptivedeviceutilizationatprimaryhealthcarefacilitiesinmekellecitynorthernethiopia