Cargando…

Case Report: A Clinical and Genetic Analysis of Childhood Growth Hormone Deficiency With Familial Hypercholesterolemia

BACKGROUND: Growth hormone deficiency (GHD) is a developmental disorder in children characterized by low growth hormone (GH), short stature and unfavorable lipid profiles. Familial hypercholesteremia (FH) is an inborn disorder of low-density lipoprotein cholesterol (LDL-C) metabolism which results i...

Descripción completa

Detalles Bibliográficos
Autores principales: Yang, Shengmin, Ke, Xiaoan, Liang, Hanting, Li, Ran, Zhu, Huijuan
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Frontiers Media S.A. 2021
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8249922/
https://www.ncbi.nlm.nih.gov/pubmed/34220717
http://dx.doi.org/10.3389/fendo.2021.691490
_version_ 1783717002514268160
author Yang, Shengmin
Ke, Xiaoan
Liang, Hanting
Li, Ran
Zhu, Huijuan
author_facet Yang, Shengmin
Ke, Xiaoan
Liang, Hanting
Li, Ran
Zhu, Huijuan
author_sort Yang, Shengmin
collection PubMed
description BACKGROUND: Growth hormone deficiency (GHD) is a developmental disorder in children characterized by low growth hormone (GH), short stature and unfavorable lipid profiles. Familial hypercholesteremia (FH) is an inborn disorder of low-density lipoprotein cholesterol (LDL-C) metabolism which results in premature cardiovascular events. The co-occurrence of GHD and FH, which may aggravate the hypercholesteremic condition in the affected individuals, had rarely been discussed in previous publication. METHODS: This work reports two cases of GHD with FH, and explores the lipid profiles of GHD children and their therapeutic response to recombinant human growth hormone (rhGH). The diagnosis of GHD is based on low peak GH level (<7 ng/mL) in GH provocation test. FH is diagnosed by high LDL-C level (≥ 4 mmol/L) and confirmed genetic mutations in the LDL-C metabolic pathway. We also searched all previously published metabolic studies on GHD children as of December 31, 2020. Information on their LDL-C, duration and dose of rhGH treatment were retrieved and summarized. RESULTS: The first case was a 5.3 year-old boy. His height was 103.6 cm (SDS = -2.29) and his peak GH in provocative test was 6.37 ng/mL. Additionally, his LDL-C was 4.80 mmol/L and he harbored a heterozygous mutation for the apolipoprotein B (APOB) gene (c.10579 C > T). The second case was a 9-year-old girl at the height of 117.3 cm (SDS = -2.91). Her GH peaked at 4.99 ng/mL in insulin-induced hypoglycemic test and 2.80 ng/mL in L-dopa test. Her LDL-C was 6.16 mmol/L, and she carried a mutated copy of the low-density lipoprotein receptor (LDLR) gene (c.809 G > A). Literature review indicated that GHD children suffered from higher baseline LDL-C, but it was significantly reduced after rhGH treatment. CONCLUSIONS: FH should be considered if a GHD child has remarkably elevated LDL-C that cannot be attributed to low GH level alone. Genetic mutations in the LDL-C metabolic pathway prevent the body from effectively metabolizing lipids, thereby resulting in early-onset hypercholesteremia and probably playing a negative role in children’s growth.
format Online
Article
Text
id pubmed-8249922
institution National Center for Biotechnology Information
language English
publishDate 2021
publisher Frontiers Media S.A.
record_format MEDLINE/PubMed
spelling pubmed-82499222021-07-03 Case Report: A Clinical and Genetic Analysis of Childhood Growth Hormone Deficiency With Familial Hypercholesterolemia Yang, Shengmin Ke, Xiaoan Liang, Hanting Li, Ran Zhu, Huijuan Front Endocrinol (Lausanne) Endocrinology BACKGROUND: Growth hormone deficiency (GHD) is a developmental disorder in children characterized by low growth hormone (GH), short stature and unfavorable lipid profiles. Familial hypercholesteremia (FH) is an inborn disorder of low-density lipoprotein cholesterol (LDL-C) metabolism which results in premature cardiovascular events. The co-occurrence of GHD and FH, which may aggravate the hypercholesteremic condition in the affected individuals, had rarely been discussed in previous publication. METHODS: This work reports two cases of GHD with FH, and explores the lipid profiles of GHD children and their therapeutic response to recombinant human growth hormone (rhGH). The diagnosis of GHD is based on low peak GH level (<7 ng/mL) in GH provocation test. FH is diagnosed by high LDL-C level (≥ 4 mmol/L) and confirmed genetic mutations in the LDL-C metabolic pathway. We also searched all previously published metabolic studies on GHD children as of December 31, 2020. Information on their LDL-C, duration and dose of rhGH treatment were retrieved and summarized. RESULTS: The first case was a 5.3 year-old boy. His height was 103.6 cm (SDS = -2.29) and his peak GH in provocative test was 6.37 ng/mL. Additionally, his LDL-C was 4.80 mmol/L and he harbored a heterozygous mutation for the apolipoprotein B (APOB) gene (c.10579 C > T). The second case was a 9-year-old girl at the height of 117.3 cm (SDS = -2.91). Her GH peaked at 4.99 ng/mL in insulin-induced hypoglycemic test and 2.80 ng/mL in L-dopa test. Her LDL-C was 6.16 mmol/L, and she carried a mutated copy of the low-density lipoprotein receptor (LDLR) gene (c.809 G > A). Literature review indicated that GHD children suffered from higher baseline LDL-C, but it was significantly reduced after rhGH treatment. CONCLUSIONS: FH should be considered if a GHD child has remarkably elevated LDL-C that cannot be attributed to low GH level alone. Genetic mutations in the LDL-C metabolic pathway prevent the body from effectively metabolizing lipids, thereby resulting in early-onset hypercholesteremia and probably playing a negative role in children’s growth. Frontiers Media S.A. 2021-06-18 /pmc/articles/PMC8249922/ /pubmed/34220717 http://dx.doi.org/10.3389/fendo.2021.691490 Text en Copyright © 2021 Yang, Ke, Liang, Li and Zhu https://creativecommons.org/licenses/by/4.0/This is an open-access article distributed under the terms of the Creative Commons Attribution License (CC BY). The use, distribution or reproduction in other forums is permitted, provided the original author(s) and the copyright owner(s) are credited and that the original publication in this journal is cited, in accordance with accepted academic practice. No use, distribution or reproduction is permitted which does not comply with these terms.
spellingShingle Endocrinology
Yang, Shengmin
Ke, Xiaoan
Liang, Hanting
Li, Ran
Zhu, Huijuan
Case Report: A Clinical and Genetic Analysis of Childhood Growth Hormone Deficiency With Familial Hypercholesterolemia
title Case Report: A Clinical and Genetic Analysis of Childhood Growth Hormone Deficiency With Familial Hypercholesterolemia
title_full Case Report: A Clinical and Genetic Analysis of Childhood Growth Hormone Deficiency With Familial Hypercholesterolemia
title_fullStr Case Report: A Clinical and Genetic Analysis of Childhood Growth Hormone Deficiency With Familial Hypercholesterolemia
title_full_unstemmed Case Report: A Clinical and Genetic Analysis of Childhood Growth Hormone Deficiency With Familial Hypercholesterolemia
title_short Case Report: A Clinical and Genetic Analysis of Childhood Growth Hormone Deficiency With Familial Hypercholesterolemia
title_sort case report: a clinical and genetic analysis of childhood growth hormone deficiency with familial hypercholesterolemia
topic Endocrinology
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8249922/
https://www.ncbi.nlm.nih.gov/pubmed/34220717
http://dx.doi.org/10.3389/fendo.2021.691490
work_keys_str_mv AT yangshengmin casereportaclinicalandgeneticanalysisofchildhoodgrowthhormonedeficiencywithfamilialhypercholesterolemia
AT kexiaoan casereportaclinicalandgeneticanalysisofchildhoodgrowthhormonedeficiencywithfamilialhypercholesterolemia
AT lianghanting casereportaclinicalandgeneticanalysisofchildhoodgrowthhormonedeficiencywithfamilialhypercholesterolemia
AT liran casereportaclinicalandgeneticanalysisofchildhoodgrowthhormonedeficiencywithfamilialhypercholesterolemia
AT zhuhuijuan casereportaclinicalandgeneticanalysisofchildhoodgrowthhormonedeficiencywithfamilialhypercholesterolemia