Cargando…
Vitamin a deficiency and sleep disturbances related to autism symptoms in children with autism spectrum disorder: a cross-sectional study
BACKGROUND: Vitamin A deficiency (VAD) and sleep disturbances have been reported in children with autism spectrum disorder (ASD). The influence of vitamin A (VA) levels on sleep regulation and sleep disturbances in ASD has garnered concern. The present study aimed to characterize the association of...
Autores principales: | , , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2021
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8254303/ https://www.ncbi.nlm.nih.gov/pubmed/34217246 http://dx.doi.org/10.1186/s12887-021-02775-0 |
_version_ | 1783717701298946048 |
---|---|
author | Wen, Jing Yang, Ting Zhu, Jiang Guo, Min Lai, Xi Tang, Ting Chen, Li Chen, Jie Xue, Ming Li, Tingyu |
author_facet | Wen, Jing Yang, Ting Zhu, Jiang Guo, Min Lai, Xi Tang, Ting Chen, Li Chen, Jie Xue, Ming Li, Tingyu |
author_sort | Wen, Jing |
collection | PubMed |
description | BACKGROUND: Vitamin A deficiency (VAD) and sleep disturbances have been reported in children with autism spectrum disorder (ASD). The influence of vitamin A (VA) levels on sleep regulation and sleep disturbances in ASD has garnered concern. The present study aimed to characterize the association of VA levels with sleep disturbances in children with ASD. METHODS: This cross-sectional study compared children with ASD (n = 856) to typically developing children (TDC; n = 316). We used the Children’s Sleep Habits Questionnaire to assess sleep disturbances, Childhood Autism Rating Scale to evaluate the severity of autism symptoms, and Autism Behavior Checklist and Social Responsiveness Scale to assess autism behaviors. Serum VA levels were estimated using high-performance liquid chromatography. Multivariable linear regression and two-way analysis of variance were performed to investigate if VAD was related to sleep disturbances in children with ASD. RESULTS: Children with ASD had lower serum VA levels and a higher prevalence of sleep disturbances than TDC did. The incidence of VAD in ASD children with sleep disturbances was higher, and the symptoms more severe than those without sleep disturbances and TDC. Interestingly, the interaction between VAD and sleep disturbances was associated with the severity of autism symptoms. CONCLUSION: VAD and sleep disturbances are associated with the core symptoms of ASD in children. Regular monitoring of sleep and VA levels may be beneficial for children with ASD. TRIAL REGISTRATION: Chinese Clinical Trial Registry, registration number: ChiCTR-ROC-14005442, registration date: December 9th 2014. |
format | Online Article Text |
id | pubmed-8254303 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2021 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-82543032021-07-06 Vitamin a deficiency and sleep disturbances related to autism symptoms in children with autism spectrum disorder: a cross-sectional study Wen, Jing Yang, Ting Zhu, Jiang Guo, Min Lai, Xi Tang, Ting Chen, Li Chen, Jie Xue, Ming Li, Tingyu BMC Pediatr Research Article BACKGROUND: Vitamin A deficiency (VAD) and sleep disturbances have been reported in children with autism spectrum disorder (ASD). The influence of vitamin A (VA) levels on sleep regulation and sleep disturbances in ASD has garnered concern. The present study aimed to characterize the association of VA levels with sleep disturbances in children with ASD. METHODS: This cross-sectional study compared children with ASD (n = 856) to typically developing children (TDC; n = 316). We used the Children’s Sleep Habits Questionnaire to assess sleep disturbances, Childhood Autism Rating Scale to evaluate the severity of autism symptoms, and Autism Behavior Checklist and Social Responsiveness Scale to assess autism behaviors. Serum VA levels were estimated using high-performance liquid chromatography. Multivariable linear regression and two-way analysis of variance were performed to investigate if VAD was related to sleep disturbances in children with ASD. RESULTS: Children with ASD had lower serum VA levels and a higher prevalence of sleep disturbances than TDC did. The incidence of VAD in ASD children with sleep disturbances was higher, and the symptoms more severe than those without sleep disturbances and TDC. Interestingly, the interaction between VAD and sleep disturbances was associated with the severity of autism symptoms. CONCLUSION: VAD and sleep disturbances are associated with the core symptoms of ASD in children. Regular monitoring of sleep and VA levels may be beneficial for children with ASD. TRIAL REGISTRATION: Chinese Clinical Trial Registry, registration number: ChiCTR-ROC-14005442, registration date: December 9th 2014. BioMed Central 2021-07-03 /pmc/articles/PMC8254303/ /pubmed/34217246 http://dx.doi.org/10.1186/s12887-021-02775-0 Text en © The Author(s) 2021 https://creativecommons.org/licenses/by/4.0/Open AccessThis article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/ (https://creativecommons.org/licenses/by/4.0/) . The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/ (https://creativecommons.org/publicdomain/zero/1.0/) ) applies to the data made available in this article, unless otherwise stated in a credit line to the data. |
spellingShingle | Research Article Wen, Jing Yang, Ting Zhu, Jiang Guo, Min Lai, Xi Tang, Ting Chen, Li Chen, Jie Xue, Ming Li, Tingyu Vitamin a deficiency and sleep disturbances related to autism symptoms in children with autism spectrum disorder: a cross-sectional study |
title | Vitamin a deficiency and sleep disturbances related to autism symptoms in children with autism spectrum disorder: a cross-sectional study |
title_full | Vitamin a deficiency and sleep disturbances related to autism symptoms in children with autism spectrum disorder: a cross-sectional study |
title_fullStr | Vitamin a deficiency and sleep disturbances related to autism symptoms in children with autism spectrum disorder: a cross-sectional study |
title_full_unstemmed | Vitamin a deficiency and sleep disturbances related to autism symptoms in children with autism spectrum disorder: a cross-sectional study |
title_short | Vitamin a deficiency and sleep disturbances related to autism symptoms in children with autism spectrum disorder: a cross-sectional study |
title_sort | vitamin a deficiency and sleep disturbances related to autism symptoms in children with autism spectrum disorder: a cross-sectional study |
topic | Research Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8254303/ https://www.ncbi.nlm.nih.gov/pubmed/34217246 http://dx.doi.org/10.1186/s12887-021-02775-0 |
work_keys_str_mv | AT wenjing vitaminadeficiencyandsleepdisturbancesrelatedtoautismsymptomsinchildrenwithautismspectrumdisorderacrosssectionalstudy AT yangting vitaminadeficiencyandsleepdisturbancesrelatedtoautismsymptomsinchildrenwithautismspectrumdisorderacrosssectionalstudy AT zhujiang vitaminadeficiencyandsleepdisturbancesrelatedtoautismsymptomsinchildrenwithautismspectrumdisorderacrosssectionalstudy AT guomin vitaminadeficiencyandsleepdisturbancesrelatedtoautismsymptomsinchildrenwithautismspectrumdisorderacrosssectionalstudy AT laixi vitaminadeficiencyandsleepdisturbancesrelatedtoautismsymptomsinchildrenwithautismspectrumdisorderacrosssectionalstudy AT tangting vitaminadeficiencyandsleepdisturbancesrelatedtoautismsymptomsinchildrenwithautismspectrumdisorderacrosssectionalstudy AT chenli vitaminadeficiencyandsleepdisturbancesrelatedtoautismsymptomsinchildrenwithautismspectrumdisorderacrosssectionalstudy AT chenjie vitaminadeficiencyandsleepdisturbancesrelatedtoautismsymptomsinchildrenwithautismspectrumdisorderacrosssectionalstudy AT xueming vitaminadeficiencyandsleepdisturbancesrelatedtoautismsymptomsinchildrenwithautismspectrumdisorderacrosssectionalstudy AT litingyu vitaminadeficiencyandsleepdisturbancesrelatedtoautismsymptomsinchildrenwithautismspectrumdisorderacrosssectionalstudy |