Cargando…

Health system factors that influence diagnostic and treatment intervals in women with breast cancer in sub-Saharan Africa: a systematic review

BACKGROUND: Breast cancer patients in sub-Saharan Africa experience long time intervals between their first presentation to a health care facility and the start of cancer treatment. The role of the health system in the increasing treatment time intervals has not been widely investigated. This review...

Descripción completa

Detalles Bibliográficos
Autores principales: Gbenonsi, Gloria, Boucham, Mouna, Belrhiti, Zakaria, Nejjari, Chakib, Huybrechts, Inge, Khalis, Mohamed
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2021
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8259007/
https://www.ncbi.nlm.nih.gov/pubmed/34229634
http://dx.doi.org/10.1186/s12889-021-11296-5
_version_ 1783718599713619968
author Gbenonsi, Gloria
Boucham, Mouna
Belrhiti, Zakaria
Nejjari, Chakib
Huybrechts, Inge
Khalis, Mohamed
author_facet Gbenonsi, Gloria
Boucham, Mouna
Belrhiti, Zakaria
Nejjari, Chakib
Huybrechts, Inge
Khalis, Mohamed
author_sort Gbenonsi, Gloria
collection PubMed
description BACKGROUND: Breast cancer patients in sub-Saharan Africa experience long time intervals between their first presentation to a health care facility and the start of cancer treatment. The role of the health system in the increasing treatment time intervals has not been widely investigated. This review aimed to identify existing information on health system factors that influence diagnostic and treatment intervals in women with breast cancer in sub-Saharan Africa to contribute to the reorientation of health policies in the region. METHODS: PubMed, ScienceDirect, African Journals Online, Mendeley, ResearchGate and Google Scholar were searched to identify relevant studies published between 2010 and July 2020. We performed a qualitative synthesis in accordance with the Preferred Reporting Items for Systematic Reviews and Meta-Analyses (PRISMA) statement. Related health system factors were extracted and classified according to the World Health Organization’s six health system building blocks. The quality of qualitative and quantitative studies was assessed by using the Critical Appraisal Skills Program Quality-Assessment Tool and the National Institute of Health Quality Assessment Tool, respectively. In addition, we used the Confidence in the Evidence from Reviews of Qualitative Research tool to assess the evidence for each qualitative finding. RESULTS: From 14,184 identified studies, this systematic review included 28 articles. We identified a total of 36 barriers and 8 facilitators that may influence diagnostic and treatment intervals in women with breast cancer. The principal health system factors identified were mainly related to human resources and service delivery, particularly difficulty accessing health care, diagnostic errors, poor management, and treatment cost. CONCLUSION: The present review shows that diagnostic and treatment intervals among women with breast cancer in sub-Saharan Africa are influenced by many related health system factors. Policy makers in sub-Saharan Africa need to tackle the financial accessibility to breast cancer treatment by adequate universal health coverage policies and reinforce the clinical competencies for health workers to ensure timely diagnosis and appropriate care for women with breast cancer in this region. SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1186/s12889-021-11296-5.
format Online
Article
Text
id pubmed-8259007
institution National Center for Biotechnology Information
language English
publishDate 2021
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-82590072021-07-06 Health system factors that influence diagnostic and treatment intervals in women with breast cancer in sub-Saharan Africa: a systematic review Gbenonsi, Gloria Boucham, Mouna Belrhiti, Zakaria Nejjari, Chakib Huybrechts, Inge Khalis, Mohamed BMC Public Health Research Article BACKGROUND: Breast cancer patients in sub-Saharan Africa experience long time intervals between their first presentation to a health care facility and the start of cancer treatment. The role of the health system in the increasing treatment time intervals has not been widely investigated. This review aimed to identify existing information on health system factors that influence diagnostic and treatment intervals in women with breast cancer in sub-Saharan Africa to contribute to the reorientation of health policies in the region. METHODS: PubMed, ScienceDirect, African Journals Online, Mendeley, ResearchGate and Google Scholar were searched to identify relevant studies published between 2010 and July 2020. We performed a qualitative synthesis in accordance with the Preferred Reporting Items for Systematic Reviews and Meta-Analyses (PRISMA) statement. Related health system factors were extracted and classified according to the World Health Organization’s six health system building blocks. The quality of qualitative and quantitative studies was assessed by using the Critical Appraisal Skills Program Quality-Assessment Tool and the National Institute of Health Quality Assessment Tool, respectively. In addition, we used the Confidence in the Evidence from Reviews of Qualitative Research tool to assess the evidence for each qualitative finding. RESULTS: From 14,184 identified studies, this systematic review included 28 articles. We identified a total of 36 barriers and 8 facilitators that may influence diagnostic and treatment intervals in women with breast cancer. The principal health system factors identified were mainly related to human resources and service delivery, particularly difficulty accessing health care, diagnostic errors, poor management, and treatment cost. CONCLUSION: The present review shows that diagnostic and treatment intervals among women with breast cancer in sub-Saharan Africa are influenced by many related health system factors. Policy makers in sub-Saharan Africa need to tackle the financial accessibility to breast cancer treatment by adequate universal health coverage policies and reinforce the clinical competencies for health workers to ensure timely diagnosis and appropriate care for women with breast cancer in this region. SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1186/s12889-021-11296-5. BioMed Central 2021-07-06 /pmc/articles/PMC8259007/ /pubmed/34229634 http://dx.doi.org/10.1186/s12889-021-11296-5 Text en © The Author(s) 2021 https://creativecommons.org/licenses/by/4.0/Open AccessThis article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/ (https://creativecommons.org/licenses/by/4.0/) . The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/ (https://creativecommons.org/publicdomain/zero/1.0/) ) applies to the data made available in this article, unless otherwise stated in a credit line to the data.
spellingShingle Research Article
Gbenonsi, Gloria
Boucham, Mouna
Belrhiti, Zakaria
Nejjari, Chakib
Huybrechts, Inge
Khalis, Mohamed
Health system factors that influence diagnostic and treatment intervals in women with breast cancer in sub-Saharan Africa: a systematic review
title Health system factors that influence diagnostic and treatment intervals in women with breast cancer in sub-Saharan Africa: a systematic review
title_full Health system factors that influence diagnostic and treatment intervals in women with breast cancer in sub-Saharan Africa: a systematic review
title_fullStr Health system factors that influence diagnostic and treatment intervals in women with breast cancer in sub-Saharan Africa: a systematic review
title_full_unstemmed Health system factors that influence diagnostic and treatment intervals in women with breast cancer in sub-Saharan Africa: a systematic review
title_short Health system factors that influence diagnostic and treatment intervals in women with breast cancer in sub-Saharan Africa: a systematic review
title_sort health system factors that influence diagnostic and treatment intervals in women with breast cancer in sub-saharan africa: a systematic review
topic Research Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8259007/
https://www.ncbi.nlm.nih.gov/pubmed/34229634
http://dx.doi.org/10.1186/s12889-021-11296-5
work_keys_str_mv AT gbenonsigloria healthsystemfactorsthatinfluencediagnosticandtreatmentintervalsinwomenwithbreastcancerinsubsaharanafricaasystematicreview
AT bouchammouna healthsystemfactorsthatinfluencediagnosticandtreatmentintervalsinwomenwithbreastcancerinsubsaharanafricaasystematicreview
AT belrhitizakaria healthsystemfactorsthatinfluencediagnosticandtreatmentintervalsinwomenwithbreastcancerinsubsaharanafricaasystematicreview
AT nejjarichakib healthsystemfactorsthatinfluencediagnosticandtreatmentintervalsinwomenwithbreastcancerinsubsaharanafricaasystematicreview
AT huybrechtsinge healthsystemfactorsthatinfluencediagnosticandtreatmentintervalsinwomenwithbreastcancerinsubsaharanafricaasystematicreview
AT khalismohamed healthsystemfactorsthatinfluencediagnosticandtreatmentintervalsinwomenwithbreastcancerinsubsaharanafricaasystematicreview