Cargando…

Design characteristics of comparative effectiveness trials for the relief of symptomatic dyspepsia: A systematic review

BACKGROUND: Dyspepsia represents a symptom domain rather than a diagnostic condition and covers a wide range of complex, underlying pathophysiologies that are not well understood. The review explores comparative effectiveness interventions for the treatment of symptomatic dyspepsia along a pragmatic...

Descripción completa

Detalles Bibliográficos
Autores principales: Elliott, Natalie, Steel, Amie, Leech, Bradley, Peng, Wenbo
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Elsevier 2021
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8260395/
https://www.ncbi.nlm.nih.gov/pubmed/34258220
http://dx.doi.org/10.1016/j.imr.2020.100663
_version_ 1783718804450181120
author Elliott, Natalie
Steel, Amie
Leech, Bradley
Peng, Wenbo
author_facet Elliott, Natalie
Steel, Amie
Leech, Bradley
Peng, Wenbo
author_sort Elliott, Natalie
collection PubMed
description BACKGROUND: Dyspepsia represents a symptom domain rather than a diagnostic condition and covers a wide range of complex, underlying pathophysiologies that are not well understood. The review explores comparative effectiveness interventions for the treatment of symptomatic dyspepsia along a pragmatic-explanatory continuum. The aim is to identify relevant design characteristics applicable to future upper gastrointestinal comparative effectiveness research employing integrative medicine. METHODS: Medline, CINAHL, Scopus, Cochrane Central Register of Controlled Trials (CENTRAL) and WHO Clinical Trials were systematically searched until January 2019. Included articles were original research with two or more comparative intervention arms for the primary outcome; relief of symptomatic dyspepsia. Evaluation of the studies was conducted using the pragmatic-explanatory continuum indicator summary (PRECIS-2) tool. RESULTS: Thirty-six articles were included in the review. A total of 68 Patient Reported Outcome Measurements (PROMs), utilizing 50 different formats were deployed across the studies. The appraisal process revealed eligibility, flexibility in adherence, flexibility in delivery and organization domains further aligned towards an explanatory design. CONCLUSION: This review identified three design characteristics relevant for future comparative effectiveness research for the treatment of upper gastrointestinal disorders in a community setting. Extensive exclusion eligibility criteria limited the generalization of comparative effectiveness study results by removing sub-groups of the target populations more at risk of dyspeptic symptoms. The requirement for entry endoscopy was found to be common and not always pragmatically justifiable. Development of validated PROMs appropriate for a generic application to upper gastrointestinal disorders would be advantageous for future comparative effectiveness research within integrative medicine.
format Online
Article
Text
id pubmed-8260395
institution National Center for Biotechnology Information
language English
publishDate 2021
publisher Elsevier
record_format MEDLINE/PubMed
spelling pubmed-82603952021-07-12 Design characteristics of comparative effectiveness trials for the relief of symptomatic dyspepsia: A systematic review Elliott, Natalie Steel, Amie Leech, Bradley Peng, Wenbo Integr Med Res Review Article BACKGROUND: Dyspepsia represents a symptom domain rather than a diagnostic condition and covers a wide range of complex, underlying pathophysiologies that are not well understood. The review explores comparative effectiveness interventions for the treatment of symptomatic dyspepsia along a pragmatic-explanatory continuum. The aim is to identify relevant design characteristics applicable to future upper gastrointestinal comparative effectiveness research employing integrative medicine. METHODS: Medline, CINAHL, Scopus, Cochrane Central Register of Controlled Trials (CENTRAL) and WHO Clinical Trials were systematically searched until January 2019. Included articles were original research with two or more comparative intervention arms for the primary outcome; relief of symptomatic dyspepsia. Evaluation of the studies was conducted using the pragmatic-explanatory continuum indicator summary (PRECIS-2) tool. RESULTS: Thirty-six articles were included in the review. A total of 68 Patient Reported Outcome Measurements (PROMs), utilizing 50 different formats were deployed across the studies. The appraisal process revealed eligibility, flexibility in adherence, flexibility in delivery and organization domains further aligned towards an explanatory design. CONCLUSION: This review identified three design characteristics relevant for future comparative effectiveness research for the treatment of upper gastrointestinal disorders in a community setting. Extensive exclusion eligibility criteria limited the generalization of comparative effectiveness study results by removing sub-groups of the target populations more at risk of dyspeptic symptoms. The requirement for entry endoscopy was found to be common and not always pragmatically justifiable. Development of validated PROMs appropriate for a generic application to upper gastrointestinal disorders would be advantageous for future comparative effectiveness research within integrative medicine. Elsevier 2021-06 2020-09-22 /pmc/articles/PMC8260395/ /pubmed/34258220 http://dx.doi.org/10.1016/j.imr.2020.100663 Text en © 2019 Published by Elsevier B.V. on behalf of Korea Institute of Oriental Medicine. https://creativecommons.org/licenses/by-nc-nd/4.0/This is an open access article under the CC BY-NC-ND license (http://creativecommons.org/licenses/by-nc-nd/4.0/).
spellingShingle Review Article
Elliott, Natalie
Steel, Amie
Leech, Bradley
Peng, Wenbo
Design characteristics of comparative effectiveness trials for the relief of symptomatic dyspepsia: A systematic review
title Design characteristics of comparative effectiveness trials for the relief of symptomatic dyspepsia: A systematic review
title_full Design characteristics of comparative effectiveness trials for the relief of symptomatic dyspepsia: A systematic review
title_fullStr Design characteristics of comparative effectiveness trials for the relief of symptomatic dyspepsia: A systematic review
title_full_unstemmed Design characteristics of comparative effectiveness trials for the relief of symptomatic dyspepsia: A systematic review
title_short Design characteristics of comparative effectiveness trials for the relief of symptomatic dyspepsia: A systematic review
title_sort design characteristics of comparative effectiveness trials for the relief of symptomatic dyspepsia: a systematic review
topic Review Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8260395/
https://www.ncbi.nlm.nih.gov/pubmed/34258220
http://dx.doi.org/10.1016/j.imr.2020.100663
work_keys_str_mv AT elliottnatalie designcharacteristicsofcomparativeeffectivenesstrialsforthereliefofsymptomaticdyspepsiaasystematicreview
AT steelamie designcharacteristicsofcomparativeeffectivenesstrialsforthereliefofsymptomaticdyspepsiaasystematicreview
AT leechbradley designcharacteristicsofcomparativeeffectivenesstrialsforthereliefofsymptomaticdyspepsiaasystematicreview
AT pengwenbo designcharacteristicsofcomparativeeffectivenesstrialsforthereliefofsymptomaticdyspepsiaasystematicreview