Cargando…
Incidence of anterior uveitis in patients with axial spondyloarthritis treated with anti-TNF or anti-IL17A: a systematic review, a pairwise and network meta-analysis of randomized controlled trials
BACKGROUND: Anterior uveitis (AU) is the most frequent extra-articular feature of axial spondyloarthritis (axSpA). We aimed to assess and compare the incidence of AU in axSpA patients treated with anti-TNF or anti-IL17A. METHODS: We systematically reviewed PubMed, EMBase, and Cochrane from inception...
Autores principales: | , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2021
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8283999/ https://www.ncbi.nlm.nih.gov/pubmed/34271991 http://dx.doi.org/10.1186/s13075-021-02549-0 |
_version_ | 1783723310420328448 |
---|---|
author | Roche, Damien Badard, Martin Boyer, Laurent Lafforgue, Pierre Pham, Thao |
author_facet | Roche, Damien Badard, Martin Boyer, Laurent Lafforgue, Pierre Pham, Thao |
author_sort | Roche, Damien |
collection | PubMed |
description | BACKGROUND: Anterior uveitis (AU) is the most frequent extra-articular feature of axial spondyloarthritis (axSpA). We aimed to assess and compare the incidence of AU in axSpA patients treated with anti-TNF or anti-IL17A. METHODS: We systematically reviewed PubMed, EMBase, and Cochrane from inception to May 3, 2020, and searched for placebo-controlled and head-to-head randomized controlled trials (RCTs) assessing anti-TNF monoclonal antibodies (mAb) or soluble receptor fusion protein or anti-IL17A in patients with axSpA according to ASAS criteria and reporting safety data on AU. Data were extracted following a predefined protocol. We did pairwise and network meta-analyses for the primary outcome of AU flares (relapse or de novo) incidence and estimated summary odds ratios (ORs). We assessed the quality of evidence using the Cochrane risk-of-bias 2.0 tool. We ranked treatments according to their effectiveness in preventing AU flare using the P-score. RESULTS: We identified 752 citations and included 33 RCTs, comprising 4544 treated patients (anti-TNF mAb 2101, etanercept [ETN] 699, anti-IL17A 1744) and 2497 placebo-receiving patients. Incidence of uveitis was lower with anti-TNF mAb versus placebo (OR = 0.46; CI 95% [0.24; 0.90]) and versus anti-IL17A (OR = 0.34; CI 95% [0.12; 0.92]. According to the P-score, the ranking from the most to the least preventive treatment of uveitis flare was as follows: anti-TNF mAb, ETN, placebo, and anti-IL17A. CONCLUSION: In RCTs assessing anti-TNF and anti-IL17A in axSpA, incident uveitis are rare events. However, this network meta-analysis demonstrates that anti-TNF mAb are associated with a lower incidence of uveitis compared to placebo and anti-IL17A. SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1186/s13075-021-02549-0. |
format | Online Article Text |
id | pubmed-8283999 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2021 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-82839992021-07-19 Incidence of anterior uveitis in patients with axial spondyloarthritis treated with anti-TNF or anti-IL17A: a systematic review, a pairwise and network meta-analysis of randomized controlled trials Roche, Damien Badard, Martin Boyer, Laurent Lafforgue, Pierre Pham, Thao Arthritis Res Ther Research Article BACKGROUND: Anterior uveitis (AU) is the most frequent extra-articular feature of axial spondyloarthritis (axSpA). We aimed to assess and compare the incidence of AU in axSpA patients treated with anti-TNF or anti-IL17A. METHODS: We systematically reviewed PubMed, EMBase, and Cochrane from inception to May 3, 2020, and searched for placebo-controlled and head-to-head randomized controlled trials (RCTs) assessing anti-TNF monoclonal antibodies (mAb) or soluble receptor fusion protein or anti-IL17A in patients with axSpA according to ASAS criteria and reporting safety data on AU. Data were extracted following a predefined protocol. We did pairwise and network meta-analyses for the primary outcome of AU flares (relapse or de novo) incidence and estimated summary odds ratios (ORs). We assessed the quality of evidence using the Cochrane risk-of-bias 2.0 tool. We ranked treatments according to their effectiveness in preventing AU flare using the P-score. RESULTS: We identified 752 citations and included 33 RCTs, comprising 4544 treated patients (anti-TNF mAb 2101, etanercept [ETN] 699, anti-IL17A 1744) and 2497 placebo-receiving patients. Incidence of uveitis was lower with anti-TNF mAb versus placebo (OR = 0.46; CI 95% [0.24; 0.90]) and versus anti-IL17A (OR = 0.34; CI 95% [0.12; 0.92]. According to the P-score, the ranking from the most to the least preventive treatment of uveitis flare was as follows: anti-TNF mAb, ETN, placebo, and anti-IL17A. CONCLUSION: In RCTs assessing anti-TNF and anti-IL17A in axSpA, incident uveitis are rare events. However, this network meta-analysis demonstrates that anti-TNF mAb are associated with a lower incidence of uveitis compared to placebo and anti-IL17A. SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1186/s13075-021-02549-0. BioMed Central 2021-07-16 2021 /pmc/articles/PMC8283999/ /pubmed/34271991 http://dx.doi.org/10.1186/s13075-021-02549-0 Text en © The Author(s) 2021 https://creativecommons.org/licenses/by/4.0/Open AccessThis article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/ (https://creativecommons.org/licenses/by/4.0/) . The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/ (https://creativecommons.org/publicdomain/zero/1.0/) ) applies to the data made available in this article, unless otherwise stated in a credit line to the data. |
spellingShingle | Research Article Roche, Damien Badard, Martin Boyer, Laurent Lafforgue, Pierre Pham, Thao Incidence of anterior uveitis in patients with axial spondyloarthritis treated with anti-TNF or anti-IL17A: a systematic review, a pairwise and network meta-analysis of randomized controlled trials |
title | Incidence of anterior uveitis in patients with axial spondyloarthritis treated with anti-TNF or anti-IL17A: a systematic review, a pairwise and network meta-analysis of randomized controlled trials |
title_full | Incidence of anterior uveitis in patients with axial spondyloarthritis treated with anti-TNF or anti-IL17A: a systematic review, a pairwise and network meta-analysis of randomized controlled trials |
title_fullStr | Incidence of anterior uveitis in patients with axial spondyloarthritis treated with anti-TNF or anti-IL17A: a systematic review, a pairwise and network meta-analysis of randomized controlled trials |
title_full_unstemmed | Incidence of anterior uveitis in patients with axial spondyloarthritis treated with anti-TNF or anti-IL17A: a systematic review, a pairwise and network meta-analysis of randomized controlled trials |
title_short | Incidence of anterior uveitis in patients with axial spondyloarthritis treated with anti-TNF or anti-IL17A: a systematic review, a pairwise and network meta-analysis of randomized controlled trials |
title_sort | incidence of anterior uveitis in patients with axial spondyloarthritis treated with anti-tnf or anti-il17a: a systematic review, a pairwise and network meta-analysis of randomized controlled trials |
topic | Research Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8283999/ https://www.ncbi.nlm.nih.gov/pubmed/34271991 http://dx.doi.org/10.1186/s13075-021-02549-0 |
work_keys_str_mv | AT rochedamien incidenceofanterioruveitisinpatientswithaxialspondyloarthritistreatedwithantitnforantiil17aasystematicreviewapairwiseandnetworkmetaanalysisofrandomizedcontrolledtrials AT badardmartin incidenceofanterioruveitisinpatientswithaxialspondyloarthritistreatedwithantitnforantiil17aasystematicreviewapairwiseandnetworkmetaanalysisofrandomizedcontrolledtrials AT boyerlaurent incidenceofanterioruveitisinpatientswithaxialspondyloarthritistreatedwithantitnforantiil17aasystematicreviewapairwiseandnetworkmetaanalysisofrandomizedcontrolledtrials AT lafforguepierre incidenceofanterioruveitisinpatientswithaxialspondyloarthritistreatedwithantitnforantiil17aasystematicreviewapairwiseandnetworkmetaanalysisofrandomizedcontrolledtrials AT phamthao incidenceofanterioruveitisinpatientswithaxialspondyloarthritistreatedwithantitnforantiil17aasystematicreviewapairwiseandnetworkmetaanalysisofrandomizedcontrolledtrials |