Cargando…
Isolation and Differentiation of Adipose-Derived Stem Cells into Odontoblast-Like Cells: A Preliminary In Vitro Study
OBJECTIVE: The aim of present study was to isolate and differentiate human adipose-derived stem cells (ASCs) into odontoblast-like cells. MATERIALS AND METHODS: In this experimental study, human adipose tissues were taken from the buccal fat pad of three individuals (mean age: 24.6 ± 2.1 years). The...
Autores principales: | , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Royan Institute
2021
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8286457/ https://www.ncbi.nlm.nih.gov/pubmed/34308571 http://dx.doi.org/10.22074/cellj.2021.7325 |
_version_ | 1783723734259990528 |
---|---|
author | Khazaei, Saber Khademi, Abbasali Nasr Esfahani, Mohammad Hossein Khazaei, Mozafar Nekoofar, Mohammad Hossein Dummer, Paul M. H. |
author_facet | Khazaei, Saber Khademi, Abbasali Nasr Esfahani, Mohammad Hossein Khazaei, Mozafar Nekoofar, Mohammad Hossein Dummer, Paul M. H. |
author_sort | Khazaei, Saber |
collection | PubMed |
description | OBJECTIVE: The aim of present study was to isolate and differentiate human adipose-derived stem cells (ASCs) into odontoblast-like cells. MATERIALS AND METHODS: In this experimental study, human adipose tissues were taken from the buccal fat pad of three individuals (mean age: 24.6 ± 2.1 years). The tissues were transferred to a laboratory in a sterile culture medium, divided into small pieces and digested by collagenase I (2 mg/mL, 60-90 minutes). ASCs were isolated by passing the cell suspension through cell strainers (70 and 40 µm), followed by incubation at 37ºC and 5% CO2in Dulbecco’s modified eagle medium (DMEM) supplemented with fetal bovine serum (FBS 5%) and penicillin/streptomycin (P/S). After three passages, the ASCs were harvested. Subsequently, flow cytometry and reverse transcriptase polymerase chain reaction (RT-PCR) were used to detect expression levels of NANOG and OCT4 to evaluate stemness. Then, a differentiation medium that included high-glucose DMEM supplemented with 10% FBS, dexamethasone (10 nM), sodium β-glycerophosphate (5 mM) and ascorbic acid (100 µM) was added. The cells were cultivated for four weeks, and the odontogenic medium was changed every two days. Cell differentiation was evaluated with Alizarin red staining and expressions of collagen I (COL1A1), dentin sialophosphoprotein (DSPP) and dentin matrix protein-1 (DMP1). RESULTS: The ASCs were effectively and easily isolated. They were negative for CD45 and positive for the CD105 and CD73 markers. The ASCs expressed OCT4 and NANOG. Differentiated cells highly expressed DSPP, COL1A1 and DMP1. Alizarin red staining revealed a positive reaction for calcium deposition. CONCLUSION: ASCs were isolated successfully in high numbers from the buccal fat pad of human volunteers and were differentiated into odontoblast-like cells. These ASCs could be considered a new source of cells for use in regenerative endodontic treatments. |
format | Online Article Text |
id | pubmed-8286457 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2021 |
publisher | Royan Institute |
record_format | MEDLINE/PubMed |
spelling | pubmed-82864572021-08-01 Isolation and Differentiation of Adipose-Derived Stem Cells into Odontoblast-Like Cells: A Preliminary In Vitro Study Khazaei, Saber Khademi, Abbasali Nasr Esfahani, Mohammad Hossein Khazaei, Mozafar Nekoofar, Mohammad Hossein Dummer, Paul M. H. Cell J Original Article OBJECTIVE: The aim of present study was to isolate and differentiate human adipose-derived stem cells (ASCs) into odontoblast-like cells. MATERIALS AND METHODS: In this experimental study, human adipose tissues were taken from the buccal fat pad of three individuals (mean age: 24.6 ± 2.1 years). The tissues were transferred to a laboratory in a sterile culture medium, divided into small pieces and digested by collagenase I (2 mg/mL, 60-90 minutes). ASCs were isolated by passing the cell suspension through cell strainers (70 and 40 µm), followed by incubation at 37ºC and 5% CO2in Dulbecco’s modified eagle medium (DMEM) supplemented with fetal bovine serum (FBS 5%) and penicillin/streptomycin (P/S). After three passages, the ASCs were harvested. Subsequently, flow cytometry and reverse transcriptase polymerase chain reaction (RT-PCR) were used to detect expression levels of NANOG and OCT4 to evaluate stemness. Then, a differentiation medium that included high-glucose DMEM supplemented with 10% FBS, dexamethasone (10 nM), sodium β-glycerophosphate (5 mM) and ascorbic acid (100 µM) was added. The cells were cultivated for four weeks, and the odontogenic medium was changed every two days. Cell differentiation was evaluated with Alizarin red staining and expressions of collagen I (COL1A1), dentin sialophosphoprotein (DSPP) and dentin matrix protein-1 (DMP1). RESULTS: The ASCs were effectively and easily isolated. They were negative for CD45 and positive for the CD105 and CD73 markers. The ASCs expressed OCT4 and NANOG. Differentiated cells highly expressed DSPP, COL1A1 and DMP1. Alizarin red staining revealed a positive reaction for calcium deposition. CONCLUSION: ASCs were isolated successfully in high numbers from the buccal fat pad of human volunteers and were differentiated into odontoblast-like cells. These ASCs could be considered a new source of cells for use in regenerative endodontic treatments. Royan Institute 2021-08 2021-07-17 /pmc/articles/PMC8286457/ /pubmed/34308571 http://dx.doi.org/10.22074/cellj.2021.7325 Text en The Cell Journal (Yakhteh) is an open access journal which means the articles are freely available online for any individual author to download and use the providing address. The journal is licensed under a Creative Commons Attribution-Non Commercial 3.0 Unported License which allows the author(s) to hold the copyright without restrictions that is permitting unrestricted use, distribution, and reproduction in any medium provided the original work is properly cited. https://creativecommons.org/licenses/by/3.0/This is an open-access article distributed under the terms of the Creative Commons Attribution License, which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited. |
spellingShingle | Original Article Khazaei, Saber Khademi, Abbasali Nasr Esfahani, Mohammad Hossein Khazaei, Mozafar Nekoofar, Mohammad Hossein Dummer, Paul M. H. Isolation and Differentiation of Adipose-Derived Stem Cells into Odontoblast-Like Cells: A Preliminary In Vitro Study |
title | Isolation and Differentiation of Adipose-Derived Stem Cells into
Odontoblast-Like Cells: A Preliminary In Vitro Study |
title_full | Isolation and Differentiation of Adipose-Derived Stem Cells into
Odontoblast-Like Cells: A Preliminary In Vitro Study |
title_fullStr | Isolation and Differentiation of Adipose-Derived Stem Cells into
Odontoblast-Like Cells: A Preliminary In Vitro Study |
title_full_unstemmed | Isolation and Differentiation of Adipose-Derived Stem Cells into
Odontoblast-Like Cells: A Preliminary In Vitro Study |
title_short | Isolation and Differentiation of Adipose-Derived Stem Cells into
Odontoblast-Like Cells: A Preliminary In Vitro Study |
title_sort | isolation and differentiation of adipose-derived stem cells into
odontoblast-like cells: a preliminary in vitro study |
topic | Original Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8286457/ https://www.ncbi.nlm.nih.gov/pubmed/34308571 http://dx.doi.org/10.22074/cellj.2021.7325 |
work_keys_str_mv | AT khazaeisaber isolationanddifferentiationofadiposederivedstemcellsintoodontoblastlikecellsapreliminaryinvitrostudy AT khademiabbasali isolationanddifferentiationofadiposederivedstemcellsintoodontoblastlikecellsapreliminaryinvitrostudy AT nasresfahanimohammadhossein isolationanddifferentiationofadiposederivedstemcellsintoodontoblastlikecellsapreliminaryinvitrostudy AT khazaeimozafar isolationanddifferentiationofadiposederivedstemcellsintoodontoblastlikecellsapreliminaryinvitrostudy AT nekoofarmohammadhossein isolationanddifferentiationofadiposederivedstemcellsintoodontoblastlikecellsapreliminaryinvitrostudy AT dummerpaulmh isolationanddifferentiationofadiposederivedstemcellsintoodontoblastlikecellsapreliminaryinvitrostudy |