Cargando…
Aralia armata (Wall.) Seem Improves Intimal Hyperplasia after Vascular Injury by Downregulating the Wnt3α/Dvl-1/β-Catenin Pathway
The aim of the study is to examine the mechanism of Aralia armata (Wall.) Seem (AAS) in improving intimal hyperplasia after vascular injury in rats. Rats with femoral artery injury were randomly divided into three groups: the model group, AAS low-dose group (40 mg/kg), and AAS high-dose group (80 mg...
Autores principales: | , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Hindawi
2021
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8292040/ https://www.ncbi.nlm.nih.gov/pubmed/34337044 http://dx.doi.org/10.1155/2021/6682525 |
_version_ | 1783724765256613888 |
---|---|
author | Zhao, Xiangpei Huang, Jinchang Mo, Zhenyu Wei, Jiangcun Zhong, Chuanmei Teng, Hongli |
author_facet | Zhao, Xiangpei Huang, Jinchang Mo, Zhenyu Wei, Jiangcun Zhong, Chuanmei Teng, Hongli |
author_sort | Zhao, Xiangpei |
collection | PubMed |
description | The aim of the study is to examine the mechanism of Aralia armata (Wall.) Seem (AAS) in improving intimal hyperplasia after vascular injury in rats. Rats with femoral artery injury were randomly divided into three groups: the model group, AAS low-dose group (40 mg/kg), and AAS high-dose group (80 mg/kg). The sham operation group was used as a control group. HE staining was used to observe the changes in femoral artery vessels. Immunohistochemistry was adopted to detect α-SMA, PCNA, GSK-3β, and β-catenin proteins in femoral artery tissue. The CCK-8 test and wound healing assay were employed to analyze the effect of AAS on proliferation and migration of vascular smooth muscle cells (VSMCs) cultured in vitro. Western blotting (WB) and polymerase chain reaction (PCR) assays were used to evaluate the molecular mechanism. AAS reduced the stenosis of blood vessels and the protein expressions of α-SMA, PCNA, GSK-3β, and β-catenin compared to the model group. In addition, AAS (0-15 μg/mL) effectively inhibited the proliferation and migration of VSMCs. Moreover, the results of WB and PCR showed that AAS could inhibit the activation of β-catenin induced by 15% FBS and significantly decrease the expression levels of Wnt3α, Dvl-1, GSK-3β, β-catenin, and cyclin D1 in the upstream and downstream of the pathway. AAS could effectively inhibit the proliferation and migration of neointima after vascular injury in rats by regulating the Wnt/β-catenin signaling pathway. |
format | Online Article Text |
id | pubmed-8292040 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2021 |
publisher | Hindawi |
record_format | MEDLINE/PubMed |
spelling | pubmed-82920402021-07-31 Aralia armata (Wall.) Seem Improves Intimal Hyperplasia after Vascular Injury by Downregulating the Wnt3α/Dvl-1/β-Catenin Pathway Zhao, Xiangpei Huang, Jinchang Mo, Zhenyu Wei, Jiangcun Zhong, Chuanmei Teng, Hongli Biomed Res Int Research Article The aim of the study is to examine the mechanism of Aralia armata (Wall.) Seem (AAS) in improving intimal hyperplasia after vascular injury in rats. Rats with femoral artery injury were randomly divided into three groups: the model group, AAS low-dose group (40 mg/kg), and AAS high-dose group (80 mg/kg). The sham operation group was used as a control group. HE staining was used to observe the changes in femoral artery vessels. Immunohistochemistry was adopted to detect α-SMA, PCNA, GSK-3β, and β-catenin proteins in femoral artery tissue. The CCK-8 test and wound healing assay were employed to analyze the effect of AAS on proliferation and migration of vascular smooth muscle cells (VSMCs) cultured in vitro. Western blotting (WB) and polymerase chain reaction (PCR) assays were used to evaluate the molecular mechanism. AAS reduced the stenosis of blood vessels and the protein expressions of α-SMA, PCNA, GSK-3β, and β-catenin compared to the model group. In addition, AAS (0-15 μg/mL) effectively inhibited the proliferation and migration of VSMCs. Moreover, the results of WB and PCR showed that AAS could inhibit the activation of β-catenin induced by 15% FBS and significantly decrease the expression levels of Wnt3α, Dvl-1, GSK-3β, β-catenin, and cyclin D1 in the upstream and downstream of the pathway. AAS could effectively inhibit the proliferation and migration of neointima after vascular injury in rats by regulating the Wnt/β-catenin signaling pathway. Hindawi 2021-07-12 /pmc/articles/PMC8292040/ /pubmed/34337044 http://dx.doi.org/10.1155/2021/6682525 Text en Copyright © 2021 Xiangpei Zhao et al. https://creativecommons.org/licenses/by/4.0/This is an open access article distributed under the Creative Commons Attribution License, which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited. |
spellingShingle | Research Article Zhao, Xiangpei Huang, Jinchang Mo, Zhenyu Wei, Jiangcun Zhong, Chuanmei Teng, Hongli Aralia armata (Wall.) Seem Improves Intimal Hyperplasia after Vascular Injury by Downregulating the Wnt3α/Dvl-1/β-Catenin Pathway |
title |
Aralia armata (Wall.) Seem Improves Intimal Hyperplasia after Vascular Injury by Downregulating the Wnt3α/Dvl-1/β-Catenin Pathway |
title_full |
Aralia armata (Wall.) Seem Improves Intimal Hyperplasia after Vascular Injury by Downregulating the Wnt3α/Dvl-1/β-Catenin Pathway |
title_fullStr |
Aralia armata (Wall.) Seem Improves Intimal Hyperplasia after Vascular Injury by Downregulating the Wnt3α/Dvl-1/β-Catenin Pathway |
title_full_unstemmed |
Aralia armata (Wall.) Seem Improves Intimal Hyperplasia after Vascular Injury by Downregulating the Wnt3α/Dvl-1/β-Catenin Pathway |
title_short |
Aralia armata (Wall.) Seem Improves Intimal Hyperplasia after Vascular Injury by Downregulating the Wnt3α/Dvl-1/β-Catenin Pathway |
title_sort | aralia armata (wall.) seem improves intimal hyperplasia after vascular injury by downregulating the wnt3α/dvl-1/β-catenin pathway |
topic | Research Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8292040/ https://www.ncbi.nlm.nih.gov/pubmed/34337044 http://dx.doi.org/10.1155/2021/6682525 |
work_keys_str_mv | AT zhaoxiangpei araliaarmatawallseemimprovesintimalhyperplasiaaftervascularinjurybydownregulatingthewnt3advl1bcateninpathway AT huangjinchang araliaarmatawallseemimprovesintimalhyperplasiaaftervascularinjurybydownregulatingthewnt3advl1bcateninpathway AT mozhenyu araliaarmatawallseemimprovesintimalhyperplasiaaftervascularinjurybydownregulatingthewnt3advl1bcateninpathway AT weijiangcun araliaarmatawallseemimprovesintimalhyperplasiaaftervascularinjurybydownregulatingthewnt3advl1bcateninpathway AT zhongchuanmei araliaarmatawallseemimprovesintimalhyperplasiaaftervascularinjurybydownregulatingthewnt3advl1bcateninpathway AT tenghongli araliaarmatawallseemimprovesintimalhyperplasiaaftervascularinjurybydownregulatingthewnt3advl1bcateninpathway |