Cargando…
Intense and Mild First Epidemic Wave of Coronavirus Disease, The Gambia
The severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) pandemic is evolving differently in Africa than in other regions. Africa has lower SARS-CoV-2 transmission rates and milder clinical manifestations. Detailed SARS-CoV-2 epidemiologic data are needed in Africa. We used publicly availabl...
Autores principales: | , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Centers for Disease Control and Prevention
2021
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8314844/ https://www.ncbi.nlm.nih.gov/pubmed/34286683 http://dx.doi.org/10.3201/eid2708.204954 |
_version_ | 1783729620082753536 |
---|---|
author | Abatan, Baderinwa Agboghoroma, Orighomisan Akemoke, Fatai Antonio, Martin Awokola, Babatunde Bittaye, Mustapha Bojang, Abdoulie Bojang, Kalifa Brotherton, Helen Cerami, Carla Clarke, Ed D’Alessandro, Umberto de Silva, Thushan Drammeh, Mariama Forrest, Karen Hofmann, Natalie Jagne, Sherifo Jah, Hawanatu Jarju, Sheikh Jaye, Assan Jobe, Modou Kampmann, Beate Manjang, Buba Martinez-Alvarez, Melisa Mohammed, Nuredin Nadjm, Behzad Ndiath, Mamadou Ousmane Nkereuwem, Esin Nwakanma, Davis Oko, Francis Okoh, Emmanuel Okomo, Uduak Olatunji, Yekini Oriero, Eniyou Prentice, Andrew M. Roberts, Charles Roca, Anna Sabally, Babanding Sambou, Sana Samateh, Ahmadou Secka, Ousman Sesay, Abdul Karim Singhateh, Yankuba Susso, Bubacarr Usuf, Effua Vilane, Aminata Wariri, Oghenebrume |
author_facet | Abatan, Baderinwa Agboghoroma, Orighomisan Akemoke, Fatai Antonio, Martin Awokola, Babatunde Bittaye, Mustapha Bojang, Abdoulie Bojang, Kalifa Brotherton, Helen Cerami, Carla Clarke, Ed D’Alessandro, Umberto de Silva, Thushan Drammeh, Mariama Forrest, Karen Hofmann, Natalie Jagne, Sherifo Jah, Hawanatu Jarju, Sheikh Jaye, Assan Jobe, Modou Kampmann, Beate Manjang, Buba Martinez-Alvarez, Melisa Mohammed, Nuredin Nadjm, Behzad Ndiath, Mamadou Ousmane Nkereuwem, Esin Nwakanma, Davis Oko, Francis Okoh, Emmanuel Okomo, Uduak Olatunji, Yekini Oriero, Eniyou Prentice, Andrew M. Roberts, Charles Roca, Anna Sabally, Babanding Sambou, Sana Samateh, Ahmadou Secka, Ousman Sesay, Abdul Karim Singhateh, Yankuba Susso, Bubacarr Usuf, Effua Vilane, Aminata Wariri, Oghenebrume |
author_sort | Abatan, Baderinwa |
collection | PubMed |
description | The severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) pandemic is evolving differently in Africa than in other regions. Africa has lower SARS-CoV-2 transmission rates and milder clinical manifestations. Detailed SARS-CoV-2 epidemiologic data are needed in Africa. We used publicly available data to calculate SARS-CoV-2 infections per 1,000 persons in The Gambia. We evaluated transmission rates among 1,366 employees of the Medical Research Council Unit The Gambia (MRCG), where systematic surveillance of symptomatic cases and contact tracing were implemented. By September 30, 2020, The Gambia had identified 3,579 SARS-CoV-2 cases, including 115 deaths; 67% of cases were identified in August. Among infections, MRCG staff accounted for 191 cases; all were asymptomatic or mild. The cumulative incidence rate among nonclinical MRCG staff was 124 infections/1,000 persons, which is >80-fold higher than estimates of diagnosed cases among the population. Systematic surveillance and seroepidemiologic surveys are needed to clarify the extent of SARS-CoV-2 transmission in Africa. |
format | Online Article Text |
id | pubmed-8314844 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2021 |
publisher | Centers for Disease Control and Prevention |
record_format | MEDLINE/PubMed |
spelling | pubmed-83148442021-08-07 Intense and Mild First Epidemic Wave of Coronavirus Disease, The Gambia Abatan, Baderinwa Agboghoroma, Orighomisan Akemoke, Fatai Antonio, Martin Awokola, Babatunde Bittaye, Mustapha Bojang, Abdoulie Bojang, Kalifa Brotherton, Helen Cerami, Carla Clarke, Ed D’Alessandro, Umberto de Silva, Thushan Drammeh, Mariama Forrest, Karen Hofmann, Natalie Jagne, Sherifo Jah, Hawanatu Jarju, Sheikh Jaye, Assan Jobe, Modou Kampmann, Beate Manjang, Buba Martinez-Alvarez, Melisa Mohammed, Nuredin Nadjm, Behzad Ndiath, Mamadou Ousmane Nkereuwem, Esin Nwakanma, Davis Oko, Francis Okoh, Emmanuel Okomo, Uduak Olatunji, Yekini Oriero, Eniyou Prentice, Andrew M. Roberts, Charles Roca, Anna Sabally, Babanding Sambou, Sana Samateh, Ahmadou Secka, Ousman Sesay, Abdul Karim Singhateh, Yankuba Susso, Bubacarr Usuf, Effua Vilane, Aminata Wariri, Oghenebrume Emerg Infect Dis Research The severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) pandemic is evolving differently in Africa than in other regions. Africa has lower SARS-CoV-2 transmission rates and milder clinical manifestations. Detailed SARS-CoV-2 epidemiologic data are needed in Africa. We used publicly available data to calculate SARS-CoV-2 infections per 1,000 persons in The Gambia. We evaluated transmission rates among 1,366 employees of the Medical Research Council Unit The Gambia (MRCG), where systematic surveillance of symptomatic cases and contact tracing were implemented. By September 30, 2020, The Gambia had identified 3,579 SARS-CoV-2 cases, including 115 deaths; 67% of cases were identified in August. Among infections, MRCG staff accounted for 191 cases; all were asymptomatic or mild. The cumulative incidence rate among nonclinical MRCG staff was 124 infections/1,000 persons, which is >80-fold higher than estimates of diagnosed cases among the population. Systematic surveillance and seroepidemiologic surveys are needed to clarify the extent of SARS-CoV-2 transmission in Africa. Centers for Disease Control and Prevention 2021-08 /pmc/articles/PMC8314844/ /pubmed/34286683 http://dx.doi.org/10.3201/eid2708.204954 Text en https://creativecommons.org/licenses/by/4.0/This is a publication of the U.S. Government. This publication is in the public domain and is therefore without copyright. All text from this work may be reprinted freely. Use of these materials should be properly cited. |
spellingShingle | Research Abatan, Baderinwa Agboghoroma, Orighomisan Akemoke, Fatai Antonio, Martin Awokola, Babatunde Bittaye, Mustapha Bojang, Abdoulie Bojang, Kalifa Brotherton, Helen Cerami, Carla Clarke, Ed D’Alessandro, Umberto de Silva, Thushan Drammeh, Mariama Forrest, Karen Hofmann, Natalie Jagne, Sherifo Jah, Hawanatu Jarju, Sheikh Jaye, Assan Jobe, Modou Kampmann, Beate Manjang, Buba Martinez-Alvarez, Melisa Mohammed, Nuredin Nadjm, Behzad Ndiath, Mamadou Ousmane Nkereuwem, Esin Nwakanma, Davis Oko, Francis Okoh, Emmanuel Okomo, Uduak Olatunji, Yekini Oriero, Eniyou Prentice, Andrew M. Roberts, Charles Roca, Anna Sabally, Babanding Sambou, Sana Samateh, Ahmadou Secka, Ousman Sesay, Abdul Karim Singhateh, Yankuba Susso, Bubacarr Usuf, Effua Vilane, Aminata Wariri, Oghenebrume Intense and Mild First Epidemic Wave of Coronavirus Disease, The Gambia |
title | Intense and Mild First Epidemic Wave of Coronavirus Disease, The Gambia |
title_full | Intense and Mild First Epidemic Wave of Coronavirus Disease, The Gambia |
title_fullStr | Intense and Mild First Epidemic Wave of Coronavirus Disease, The Gambia |
title_full_unstemmed | Intense and Mild First Epidemic Wave of Coronavirus Disease, The Gambia |
title_short | Intense and Mild First Epidemic Wave of Coronavirus Disease, The Gambia |
title_sort | intense and mild first epidemic wave of coronavirus disease, the gambia |
topic | Research |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8314844/ https://www.ncbi.nlm.nih.gov/pubmed/34286683 http://dx.doi.org/10.3201/eid2708.204954 |
work_keys_str_mv | AT abatanbaderinwa intenseandmildfirstepidemicwaveofcoronavirusdiseasethegambia AT agboghoromaorighomisan intenseandmildfirstepidemicwaveofcoronavirusdiseasethegambia AT akemokefatai intenseandmildfirstepidemicwaveofcoronavirusdiseasethegambia AT antoniomartin intenseandmildfirstepidemicwaveofcoronavirusdiseasethegambia AT awokolababatunde intenseandmildfirstepidemicwaveofcoronavirusdiseasethegambia AT bittayemustapha intenseandmildfirstepidemicwaveofcoronavirusdiseasethegambia AT bojangabdoulie intenseandmildfirstepidemicwaveofcoronavirusdiseasethegambia AT bojangkalifa intenseandmildfirstepidemicwaveofcoronavirusdiseasethegambia AT brothertonhelen intenseandmildfirstepidemicwaveofcoronavirusdiseasethegambia AT ceramicarla intenseandmildfirstepidemicwaveofcoronavirusdiseasethegambia AT clarkeed intenseandmildfirstepidemicwaveofcoronavirusdiseasethegambia AT dalessandroumberto intenseandmildfirstepidemicwaveofcoronavirusdiseasethegambia AT desilvathushan intenseandmildfirstepidemicwaveofcoronavirusdiseasethegambia AT drammehmariama intenseandmildfirstepidemicwaveofcoronavirusdiseasethegambia AT forrestkaren intenseandmildfirstepidemicwaveofcoronavirusdiseasethegambia AT hofmannnatalie intenseandmildfirstepidemicwaveofcoronavirusdiseasethegambia AT jagnesherifo intenseandmildfirstepidemicwaveofcoronavirusdiseasethegambia AT jahhawanatu intenseandmildfirstepidemicwaveofcoronavirusdiseasethegambia AT jarjusheikh intenseandmildfirstepidemicwaveofcoronavirusdiseasethegambia AT jayeassan intenseandmildfirstepidemicwaveofcoronavirusdiseasethegambia AT jobemodou intenseandmildfirstepidemicwaveofcoronavirusdiseasethegambia AT kampmannbeate intenseandmildfirstepidemicwaveofcoronavirusdiseasethegambia AT manjangbuba intenseandmildfirstepidemicwaveofcoronavirusdiseasethegambia AT martinezalvarezmelisa intenseandmildfirstepidemicwaveofcoronavirusdiseasethegambia AT mohammednuredin intenseandmildfirstepidemicwaveofcoronavirusdiseasethegambia AT nadjmbehzad intenseandmildfirstepidemicwaveofcoronavirusdiseasethegambia AT ndiathmamadouousmane intenseandmildfirstepidemicwaveofcoronavirusdiseasethegambia AT nkereuwemesin intenseandmildfirstepidemicwaveofcoronavirusdiseasethegambia AT nwakanmadavis intenseandmildfirstepidemicwaveofcoronavirusdiseasethegambia AT okofrancis intenseandmildfirstepidemicwaveofcoronavirusdiseasethegambia AT okohemmanuel intenseandmildfirstepidemicwaveofcoronavirusdiseasethegambia AT okomouduak intenseandmildfirstepidemicwaveofcoronavirusdiseasethegambia AT olatunjiyekini intenseandmildfirstepidemicwaveofcoronavirusdiseasethegambia AT orieroeniyou intenseandmildfirstepidemicwaveofcoronavirusdiseasethegambia AT prenticeandrewm intenseandmildfirstepidemicwaveofcoronavirusdiseasethegambia AT robertscharles intenseandmildfirstepidemicwaveofcoronavirusdiseasethegambia AT rocaanna intenseandmildfirstepidemicwaveofcoronavirusdiseasethegambia AT saballybabanding intenseandmildfirstepidemicwaveofcoronavirusdiseasethegambia AT sambousana intenseandmildfirstepidemicwaveofcoronavirusdiseasethegambia AT samatehahmadou intenseandmildfirstepidemicwaveofcoronavirusdiseasethegambia AT seckaousman intenseandmildfirstepidemicwaveofcoronavirusdiseasethegambia AT sesayabdulkarim intenseandmildfirstepidemicwaveofcoronavirusdiseasethegambia AT singhatehyankuba intenseandmildfirstepidemicwaveofcoronavirusdiseasethegambia AT sussobubacarr intenseandmildfirstepidemicwaveofcoronavirusdiseasethegambia AT usufeffua intenseandmildfirstepidemicwaveofcoronavirusdiseasethegambia AT vilaneaminata intenseandmildfirstepidemicwaveofcoronavirusdiseasethegambia AT waririoghenebrume intenseandmildfirstepidemicwaveofcoronavirusdiseasethegambia |