Cargando…
Corrigendum: The Stand-Alone PilZ-Domain Protein MotL Specifically Regulates the Activity of the Secondary Lateral Flagellar System in Shewanella putrefaciens
| Autores principales: | , , , , , , , |
|---|---|
| Formato: | Online Artículo Texto |
| Lenguaje: | English |
| Publicado: |
Frontiers Media S.A.
2021
|
| Materias: | |
| Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8322970/ https://www.ncbi.nlm.nih.gov/pubmed/34335556 http://dx.doi.org/10.3389/fmicb.2021.726192 |
| _version_ | 1783731153068359680 |
|---|---|
| author | Pecina, Anna Schwan, Meike Blagotinsek, Vitan Rick, Tim Klüber, Patrick Leonhard, Tabea Bange, Gert Thormann, Kai M. |
| author_facet | Pecina, Anna Schwan, Meike Blagotinsek, Vitan Rick, Tim Klüber, Patrick Leonhard, Tabea Bange, Gert Thormann, Kai M. |
| author_sort | Pecina, Anna |
| collection | PubMed |
| description | |
| format | Online Article Text |
| id | pubmed-8322970 |
| institution | National Center for Biotechnology Information |
| language | English |
| publishDate | 2021 |
| publisher | Frontiers Media S.A. |
| record_format | MEDLINE/PubMed |
| spelling | pubmed-83229702021-07-31 Corrigendum: The Stand-Alone PilZ-Domain Protein MotL Specifically Regulates the Activity of the Secondary Lateral Flagellar System in Shewanella putrefaciens Pecina, Anna Schwan, Meike Blagotinsek, Vitan Rick, Tim Klüber, Patrick Leonhard, Tabea Bange, Gert Thormann, Kai M. Front Microbiol Microbiology Frontiers Media S.A. 2021-07-16 /pmc/articles/PMC8322970/ /pubmed/34335556 http://dx.doi.org/10.3389/fmicb.2021.726192 Text en Copyright © 2021 Pecina, Schwan, Blagotinsek, Rick, Klüber, Leonhard, Bange and Thormann. https://creativecommons.org/licenses/by/4.0/This is an open-access article distributed under the terms of the Creative Commons Attribution License (CC BY). The use, distribution or reproduction in other forums is permitted, provided the original author(s) and the copyright owner(s) are credited and that the original publication in this journal is cited, in accordance with accepted academic practice. No use, distribution or reproduction is permitted which does not comply with these terms. |
| spellingShingle | Microbiology Pecina, Anna Schwan, Meike Blagotinsek, Vitan Rick, Tim Klüber, Patrick Leonhard, Tabea Bange, Gert Thormann, Kai M. Corrigendum: The Stand-Alone PilZ-Domain Protein MotL Specifically Regulates the Activity of the Secondary Lateral Flagellar System in Shewanella putrefaciens |
| title | Corrigendum: The Stand-Alone PilZ-Domain Protein MotL Specifically Regulates the Activity of the Secondary Lateral Flagellar System in Shewanella putrefaciens |
| title_full | Corrigendum: The Stand-Alone PilZ-Domain Protein MotL Specifically Regulates the Activity of the Secondary Lateral Flagellar System in Shewanella putrefaciens |
| title_fullStr | Corrigendum: The Stand-Alone PilZ-Domain Protein MotL Specifically Regulates the Activity of the Secondary Lateral Flagellar System in Shewanella putrefaciens |
| title_full_unstemmed | Corrigendum: The Stand-Alone PilZ-Domain Protein MotL Specifically Regulates the Activity of the Secondary Lateral Flagellar System in Shewanella putrefaciens |
| title_short | Corrigendum: The Stand-Alone PilZ-Domain Protein MotL Specifically Regulates the Activity of the Secondary Lateral Flagellar System in Shewanella putrefaciens |
| title_sort | corrigendum: the stand-alone pilz-domain protein motl specifically regulates the activity of the secondary lateral flagellar system in shewanella putrefaciens |
| topic | Microbiology |
| url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8322970/ https://www.ncbi.nlm.nih.gov/pubmed/34335556 http://dx.doi.org/10.3389/fmicb.2021.726192 |
| work_keys_str_mv | AT pecinaanna corrigendumthestandalonepilzdomainproteinmotlspecificallyregulatestheactivityofthesecondarylateralflagellarsysteminshewanellaputrefaciens AT schwanmeike corrigendumthestandalonepilzdomainproteinmotlspecificallyregulatestheactivityofthesecondarylateralflagellarsysteminshewanellaputrefaciens AT blagotinsekvitan corrigendumthestandalonepilzdomainproteinmotlspecificallyregulatestheactivityofthesecondarylateralflagellarsysteminshewanellaputrefaciens AT ricktim corrigendumthestandalonepilzdomainproteinmotlspecificallyregulatestheactivityofthesecondarylateralflagellarsysteminshewanellaputrefaciens AT kluberpatrick corrigendumthestandalonepilzdomainproteinmotlspecificallyregulatestheactivityofthesecondarylateralflagellarsysteminshewanellaputrefaciens AT leonhardtabea corrigendumthestandalonepilzdomainproteinmotlspecificallyregulatestheactivityofthesecondarylateralflagellarsysteminshewanellaputrefaciens AT bangegert corrigendumthestandalonepilzdomainproteinmotlspecificallyregulatestheactivityofthesecondarylateralflagellarsysteminshewanellaputrefaciens AT thormannkaim corrigendumthestandalonepilzdomainproteinmotlspecificallyregulatestheactivityofthesecondarylateralflagellarsysteminshewanellaputrefaciens |