Cargando…

Disease burden and quality of life in children with sickle cell disease in Italy: time to be considered a priority

The objective of the present article is to highlight the need for attention to Quality of Life of patients with Sickle Cell Disease living in Italy. The transformation of sickle cell disease from a severe life-threatening disease of childhood into a chronic, lifelong condition due to the significant...

Descripción completa

Detalles Bibliográficos
Autores principales: Colombatti, Raffaella, Casale, Maddalena, Russo, Giovanna
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2021
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8323323/
https://www.ncbi.nlm.nih.gov/pubmed/34325732
http://dx.doi.org/10.1186/s13052-021-01109-1
_version_ 1783731218903203840
author Colombatti, Raffaella
Casale, Maddalena
Russo, Giovanna
author_facet Colombatti, Raffaella
Casale, Maddalena
Russo, Giovanna
author_sort Colombatti, Raffaella
collection PubMed
description The objective of the present article is to highlight the need for attention to Quality of Life of patients with Sickle Cell Disease living in Italy. The transformation of sickle cell disease from a severe life-threatening disease of childhood into a chronic, lifelong condition due to the significant improvements in care and treatment options, imposes increasing new challenges to health care providers and patients. Patients now face physical, psychosocial and emotional challenges throughout their lives. They generally have to receive chronic treatments and regular multidisciplinary monitoring which increase social and emotional burden rendering adherence to treatment sometimes complicated. A chronic disease impacts all aspects of patients’ lives, not only the physical one, but also the social and emotional aspects as well as the educational and working life. The entire “Quality of Life” is affected and recent evidence demonstrates the importance quality of life has for patients with chronic illness. The results of this review focus on emerging data regarding quality of life across the lifespan of patients with Sickle Cell Disease, and highlight the need for more action in this field in Italy, where recent immigration and improved care determine an increasing population of children with sickle cell disease being taken into long term care.
format Online
Article
Text
id pubmed-8323323
institution National Center for Biotechnology Information
language English
publishDate 2021
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-83233232021-07-30 Disease burden and quality of life in children with sickle cell disease in Italy: time to be considered a priority Colombatti, Raffaella Casale, Maddalena Russo, Giovanna Ital J Pediatr Commentary The objective of the present article is to highlight the need for attention to Quality of Life of patients with Sickle Cell Disease living in Italy. The transformation of sickle cell disease from a severe life-threatening disease of childhood into a chronic, lifelong condition due to the significant improvements in care and treatment options, imposes increasing new challenges to health care providers and patients. Patients now face physical, psychosocial and emotional challenges throughout their lives. They generally have to receive chronic treatments and regular multidisciplinary monitoring which increase social and emotional burden rendering adherence to treatment sometimes complicated. A chronic disease impacts all aspects of patients’ lives, not only the physical one, but also the social and emotional aspects as well as the educational and working life. The entire “Quality of Life” is affected and recent evidence demonstrates the importance quality of life has for patients with chronic illness. The results of this review focus on emerging data regarding quality of life across the lifespan of patients with Sickle Cell Disease, and highlight the need for more action in this field in Italy, where recent immigration and improved care determine an increasing population of children with sickle cell disease being taken into long term care. BioMed Central 2021-07-29 /pmc/articles/PMC8323323/ /pubmed/34325732 http://dx.doi.org/10.1186/s13052-021-01109-1 Text en © The Author(s) 2021 https://creativecommons.org/licenses/by/4.0/Open AccessThis article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/ (https://creativecommons.org/licenses/by/4.0/) . The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/ (https://creativecommons.org/publicdomain/zero/1.0/) ) applies to the data made available in this article, unless otherwise stated in a credit line to the data.
spellingShingle Commentary
Colombatti, Raffaella
Casale, Maddalena
Russo, Giovanna
Disease burden and quality of life in children with sickle cell disease in Italy: time to be considered a priority
title Disease burden and quality of life in children with sickle cell disease in Italy: time to be considered a priority
title_full Disease burden and quality of life in children with sickle cell disease in Italy: time to be considered a priority
title_fullStr Disease burden and quality of life in children with sickle cell disease in Italy: time to be considered a priority
title_full_unstemmed Disease burden and quality of life in children with sickle cell disease in Italy: time to be considered a priority
title_short Disease burden and quality of life in children with sickle cell disease in Italy: time to be considered a priority
title_sort disease burden and quality of life in children with sickle cell disease in italy: time to be considered a priority
topic Commentary
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8323323/
https://www.ncbi.nlm.nih.gov/pubmed/34325732
http://dx.doi.org/10.1186/s13052-021-01109-1
work_keys_str_mv AT colombattiraffaella diseaseburdenandqualityoflifeinchildrenwithsicklecelldiseaseinitalytimetobeconsideredapriority
AT casalemaddalena diseaseburdenandqualityoflifeinchildrenwithsicklecelldiseaseinitalytimetobeconsideredapriority
AT russogiovanna diseaseburdenandqualityoflifeinchildrenwithsicklecelldiseaseinitalytimetobeconsideredapriority