Cargando…

Does drug dispensing improve the health outcomes of patients attending community pharmacies? A systematic review

BACKGROUND: Drug dispensing is a clinical pharmacy service that promotes access to medicines and their rational use. However, there is a lack of evidence for the impact of drug dispensing on patients’ health outcomes. Thus, the purpose of this study was to assess the influence of drug dispensing on...

Descripción completa

Detalles Bibliográficos
Autores principales: Pizetta, Bárbara, Raggi, Lívia Gonçalves, Rocha, Kérilin Stancine Santos, Cerqueira-Santos, Sabrina, de Lyra-Jr, Divaldo Pereira, dos Santos Júnior, Genival Araujo
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2021
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8330087/
https://www.ncbi.nlm.nih.gov/pubmed/34340700
http://dx.doi.org/10.1186/s12913-021-06770-0
_version_ 1783732629806252032
author Pizetta, Bárbara
Raggi, Lívia Gonçalves
Rocha, Kérilin Stancine Santos
Cerqueira-Santos, Sabrina
de Lyra-Jr, Divaldo Pereira
dos Santos Júnior, Genival Araujo
author_facet Pizetta, Bárbara
Raggi, Lívia Gonçalves
Rocha, Kérilin Stancine Santos
Cerqueira-Santos, Sabrina
de Lyra-Jr, Divaldo Pereira
dos Santos Júnior, Genival Araujo
author_sort Pizetta, Bárbara
collection PubMed
description BACKGROUND: Drug dispensing is a clinical pharmacy service that promotes access to medicines and their rational use. However, there is a lack of evidence for the impact of drug dispensing on patients’ health outcomes. Thus, the purpose of this study was to assess the influence of drug dispensing on the clinical, humanistic, and economic outcomes of patients attending community pharmacies. METHODS: A systematic literature search was performed in April 2021 using PubMed, Web of Science, Cochrane Library, LILACS, and Open Thesis. Two reviewers screened titles, abstracts, and full-text articles according to the eligibility criteria. Methodological quality was assessed using tools from the Joanna Briggs Institute, and the literature was synthesized narratively. RESULTS: We retrieved 3,685 articles and included nine studies that presented 13 different outcomes. Regarding the design, they were cross-sectional (n = 4), randomized clinical trials (n = 4), and quasi-experimental (n = 1). A positive influence of drug dispensing on health outcomes was demonstrated through six clinical, four humanistic and three economic outcomes. Eight studies (88,9 %) used intermediate outcomes. The assessment of methodological quality was characterized by a lack of clarity and/or lack of information in primary studies. CONCLUSIONS: Most articles included in this review reported a positive influence of drug dispensing performed by community pharmacists on patients’ health outcomes. The findings of this study may be of interest to patients, pharmacists, decision makers, and healthcare systems, since they may contribute to evidence-based decision-making, strengthening the contribution of community pharmacists to health care. TRIAL REGISTRATION: Registration: PROSPERO CRD42020191701. SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1186/s12913-021-06770-0.
format Online
Article
Text
id pubmed-8330087
institution National Center for Biotechnology Information
language English
publishDate 2021
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-83300872021-08-04 Does drug dispensing improve the health outcomes of patients attending community pharmacies? A systematic review Pizetta, Bárbara Raggi, Lívia Gonçalves Rocha, Kérilin Stancine Santos Cerqueira-Santos, Sabrina de Lyra-Jr, Divaldo Pereira dos Santos Júnior, Genival Araujo BMC Health Serv Res Research BACKGROUND: Drug dispensing is a clinical pharmacy service that promotes access to medicines and their rational use. However, there is a lack of evidence for the impact of drug dispensing on patients’ health outcomes. Thus, the purpose of this study was to assess the influence of drug dispensing on the clinical, humanistic, and economic outcomes of patients attending community pharmacies. METHODS: A systematic literature search was performed in April 2021 using PubMed, Web of Science, Cochrane Library, LILACS, and Open Thesis. Two reviewers screened titles, abstracts, and full-text articles according to the eligibility criteria. Methodological quality was assessed using tools from the Joanna Briggs Institute, and the literature was synthesized narratively. RESULTS: We retrieved 3,685 articles and included nine studies that presented 13 different outcomes. Regarding the design, they were cross-sectional (n = 4), randomized clinical trials (n = 4), and quasi-experimental (n = 1). A positive influence of drug dispensing on health outcomes was demonstrated through six clinical, four humanistic and three economic outcomes. Eight studies (88,9 %) used intermediate outcomes. The assessment of methodological quality was characterized by a lack of clarity and/or lack of information in primary studies. CONCLUSIONS: Most articles included in this review reported a positive influence of drug dispensing performed by community pharmacists on patients’ health outcomes. The findings of this study may be of interest to patients, pharmacists, decision makers, and healthcare systems, since they may contribute to evidence-based decision-making, strengthening the contribution of community pharmacists to health care. TRIAL REGISTRATION: Registration: PROSPERO CRD42020191701. SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1186/s12913-021-06770-0. BioMed Central 2021-08-02 /pmc/articles/PMC8330087/ /pubmed/34340700 http://dx.doi.org/10.1186/s12913-021-06770-0 Text en © The Author(s) 2021 https://creativecommons.org/licenses/by/4.0/Open AccessThis article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/ (https://creativecommons.org/licenses/by/4.0/) . The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/ (https://creativecommons.org/publicdomain/zero/1.0/) ) applies to the data made available in this article, unless otherwise stated in a credit line to the data.
spellingShingle Research
Pizetta, Bárbara
Raggi, Lívia Gonçalves
Rocha, Kérilin Stancine Santos
Cerqueira-Santos, Sabrina
de Lyra-Jr, Divaldo Pereira
dos Santos Júnior, Genival Araujo
Does drug dispensing improve the health outcomes of patients attending community pharmacies? A systematic review
title Does drug dispensing improve the health outcomes of patients attending community pharmacies? A systematic review
title_full Does drug dispensing improve the health outcomes of patients attending community pharmacies? A systematic review
title_fullStr Does drug dispensing improve the health outcomes of patients attending community pharmacies? A systematic review
title_full_unstemmed Does drug dispensing improve the health outcomes of patients attending community pharmacies? A systematic review
title_short Does drug dispensing improve the health outcomes of patients attending community pharmacies? A systematic review
title_sort does drug dispensing improve the health outcomes of patients attending community pharmacies? a systematic review
topic Research
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8330087/
https://www.ncbi.nlm.nih.gov/pubmed/34340700
http://dx.doi.org/10.1186/s12913-021-06770-0
work_keys_str_mv AT pizettabarbara doesdrugdispensingimprovethehealthoutcomesofpatientsattendingcommunitypharmaciesasystematicreview
AT raggiliviagoncalves doesdrugdispensingimprovethehealthoutcomesofpatientsattendingcommunitypharmaciesasystematicreview
AT rochakerilinstancinesantos doesdrugdispensingimprovethehealthoutcomesofpatientsattendingcommunitypharmaciesasystematicreview
AT cerqueirasantossabrina doesdrugdispensingimprovethehealthoutcomesofpatientsattendingcommunitypharmaciesasystematicreview
AT delyrajrdivaldopereira doesdrugdispensingimprovethehealthoutcomesofpatientsattendingcommunitypharmaciesasystematicreview
AT dossantosjuniorgenivalaraujo doesdrugdispensingimprovethehealthoutcomesofpatientsattendingcommunitypharmaciesasystematicreview