Cargando…

Donkey-derived anti-CDV IgG, as a passive immunotherapy agent, can effectively increase survival rates of the experimental CDV-infected dogs

BACKGROUND: Humoral immunity plays an important role in the prevention of canine distemper. Anti-CD virus (CDV) antibody has strong antiviral activity and is widely used in the treatment of CD. However, with the increase of CD cases, the availability of therapeutic CD antibody fell short of the clin...

Descripción completa

Detalles Bibliográficos
Autores principales: Zhang, Jianlou, Cui, Dan, Zuo, Yuzhu, Zheng, Zhiqiang, Wu, Fengyang, Li, Wenyan, Zhang, Yonghong, Huo, Shanshan, Li, Nan, Li, Lanhui, Guan, Yueqiang, Zhong, Fei
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2021
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8344326/
https://www.ncbi.nlm.nih.gov/pubmed/34362358
http://dx.doi.org/10.1186/s12917-021-02982-y
_version_ 1783734465321762816
author Zhang, Jianlou
Cui, Dan
Zuo, Yuzhu
Zheng, Zhiqiang
Wu, Fengyang
Li, Wenyan
Zhang, Yonghong
Huo, Shanshan
Li, Nan
Li, Lanhui
Guan, Yueqiang
Zhong, Fei
author_facet Zhang, Jianlou
Cui, Dan
Zuo, Yuzhu
Zheng, Zhiqiang
Wu, Fengyang
Li, Wenyan
Zhang, Yonghong
Huo, Shanshan
Li, Nan
Li, Lanhui
Guan, Yueqiang
Zhong, Fei
author_sort Zhang, Jianlou
collection PubMed
description BACKGROUND: Humoral immunity plays an important role in the prevention of canine distemper. Anti-CD virus (CDV) antibody has strong antiviral activity and is widely used in the treatment of CD. However, with the increase of CD cases, the availability of therapeutic CD antibody fell short of the clinical needs. RESULTS: The high-titer antiserum with the high-titer neutralizing activity against CDV was obtained from the donkeys (Dezhou Donkey) immunized with the inactivated CDV vaccine. The donkey anti-CDV IgG was purified from the donkey serum, which was identified to significantly inhibit the CDV replication in the cultured Vero cells and effectively reduce the clinical symptoms and increase the survival rates (75%) of CDV-infected dogs (Shih-tzu Dog), similar to that treated with the dog-derived anti-CDV IgG. These results indicate that donkey-derived IgG is a potential substitute for dog-derived IgG to treat the CD in clinic. CONCLUSIONS: Administration of donkey-derived anti-CDV IgG can ameliorate clinical symptoms and inhibit virus replication, thereby increasing the survival of CDV-infected dogs. This study opens up a new source of therapeutic antibody for CD treatment.
format Online
Article
Text
id pubmed-8344326
institution National Center for Biotechnology Information
language English
publishDate 2021
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-83443262021-08-09 Donkey-derived anti-CDV IgG, as a passive immunotherapy agent, can effectively increase survival rates of the experimental CDV-infected dogs Zhang, Jianlou Cui, Dan Zuo, Yuzhu Zheng, Zhiqiang Wu, Fengyang Li, Wenyan Zhang, Yonghong Huo, Shanshan Li, Nan Li, Lanhui Guan, Yueqiang Zhong, Fei BMC Vet Res Research Article BACKGROUND: Humoral immunity plays an important role in the prevention of canine distemper. Anti-CD virus (CDV) antibody has strong antiviral activity and is widely used in the treatment of CD. However, with the increase of CD cases, the availability of therapeutic CD antibody fell short of the clinical needs. RESULTS: The high-titer antiserum with the high-titer neutralizing activity against CDV was obtained from the donkeys (Dezhou Donkey) immunized with the inactivated CDV vaccine. The donkey anti-CDV IgG was purified from the donkey serum, which was identified to significantly inhibit the CDV replication in the cultured Vero cells and effectively reduce the clinical symptoms and increase the survival rates (75%) of CDV-infected dogs (Shih-tzu Dog), similar to that treated with the dog-derived anti-CDV IgG. These results indicate that donkey-derived IgG is a potential substitute for dog-derived IgG to treat the CD in clinic. CONCLUSIONS: Administration of donkey-derived anti-CDV IgG can ameliorate clinical symptoms and inhibit virus replication, thereby increasing the survival of CDV-infected dogs. This study opens up a new source of therapeutic antibody for CD treatment. BioMed Central 2021-08-06 /pmc/articles/PMC8344326/ /pubmed/34362358 http://dx.doi.org/10.1186/s12917-021-02982-y Text en © The Author(s) 2021 https://creativecommons.org/licenses/by/4.0/Open AccessThis article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/ (https://creativecommons.org/licenses/by/4.0/) . The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/ (https://creativecommons.org/publicdomain/zero/1.0/) ) applies to the data made available in this article, unless otherwise stated in a credit line to the data.
spellingShingle Research Article
Zhang, Jianlou
Cui, Dan
Zuo, Yuzhu
Zheng, Zhiqiang
Wu, Fengyang
Li, Wenyan
Zhang, Yonghong
Huo, Shanshan
Li, Nan
Li, Lanhui
Guan, Yueqiang
Zhong, Fei
Donkey-derived anti-CDV IgG, as a passive immunotherapy agent, can effectively increase survival rates of the experimental CDV-infected dogs
title Donkey-derived anti-CDV IgG, as a passive immunotherapy agent, can effectively increase survival rates of the experimental CDV-infected dogs
title_full Donkey-derived anti-CDV IgG, as a passive immunotherapy agent, can effectively increase survival rates of the experimental CDV-infected dogs
title_fullStr Donkey-derived anti-CDV IgG, as a passive immunotherapy agent, can effectively increase survival rates of the experimental CDV-infected dogs
title_full_unstemmed Donkey-derived anti-CDV IgG, as a passive immunotherapy agent, can effectively increase survival rates of the experimental CDV-infected dogs
title_short Donkey-derived anti-CDV IgG, as a passive immunotherapy agent, can effectively increase survival rates of the experimental CDV-infected dogs
title_sort donkey-derived anti-cdv igg, as a passive immunotherapy agent, can effectively increase survival rates of the experimental cdv-infected dogs
topic Research Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8344326/
https://www.ncbi.nlm.nih.gov/pubmed/34362358
http://dx.doi.org/10.1186/s12917-021-02982-y
work_keys_str_mv AT zhangjianlou donkeyderivedanticdviggasapassiveimmunotherapyagentcaneffectivelyincreasesurvivalratesoftheexperimentalcdvinfecteddogs
AT cuidan donkeyderivedanticdviggasapassiveimmunotherapyagentcaneffectivelyincreasesurvivalratesoftheexperimentalcdvinfecteddogs
AT zuoyuzhu donkeyderivedanticdviggasapassiveimmunotherapyagentcaneffectivelyincreasesurvivalratesoftheexperimentalcdvinfecteddogs
AT zhengzhiqiang donkeyderivedanticdviggasapassiveimmunotherapyagentcaneffectivelyincreasesurvivalratesoftheexperimentalcdvinfecteddogs
AT wufengyang donkeyderivedanticdviggasapassiveimmunotherapyagentcaneffectivelyincreasesurvivalratesoftheexperimentalcdvinfecteddogs
AT liwenyan donkeyderivedanticdviggasapassiveimmunotherapyagentcaneffectivelyincreasesurvivalratesoftheexperimentalcdvinfecteddogs
AT zhangyonghong donkeyderivedanticdviggasapassiveimmunotherapyagentcaneffectivelyincreasesurvivalratesoftheexperimentalcdvinfecteddogs
AT huoshanshan donkeyderivedanticdviggasapassiveimmunotherapyagentcaneffectivelyincreasesurvivalratesoftheexperimentalcdvinfecteddogs
AT linan donkeyderivedanticdviggasapassiveimmunotherapyagentcaneffectivelyincreasesurvivalratesoftheexperimentalcdvinfecteddogs
AT lilanhui donkeyderivedanticdviggasapassiveimmunotherapyagentcaneffectivelyincreasesurvivalratesoftheexperimentalcdvinfecteddogs
AT guanyueqiang donkeyderivedanticdviggasapassiveimmunotherapyagentcaneffectivelyincreasesurvivalratesoftheexperimentalcdvinfecteddogs
AT zhongfei donkeyderivedanticdviggasapassiveimmunotherapyagentcaneffectivelyincreasesurvivalratesoftheexperimentalcdvinfecteddogs