Cargando…

Role of Klotho in Hyperglycemia: Its Levels and Effects on Fibroblast Growth Factor Receptors, Glycolysis, and Glomerular Filtration

Hyperglycemic conditions (HG), at early stages of diabetic nephropathy (DN), cause a decrease in podocyte numbers and an aberration of their function as key cells for glomerular plasma filtration. Klotho protein was shown to overcome some negative effects of hyperglycemia. Klotho is also a corecepto...

Descripción completa

Detalles Bibliográficos
Autores principales: Typiak, Marlena, Kulesza, Tomasz, Rachubik, Patrycja, Rogacka, Dorota, Audzeyenka, Irena, Angielski, Stefan, Saleem, Moin A., Piwkowska, Agnieszka
Formato: Online Artículo Texto
Lenguaje:English
Publicado: MDPI 2021
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8345972/
https://www.ncbi.nlm.nih.gov/pubmed/34360633
http://dx.doi.org/10.3390/ijms22157867
_version_ 1783734757189746688
author Typiak, Marlena
Kulesza, Tomasz
Rachubik, Patrycja
Rogacka, Dorota
Audzeyenka, Irena
Angielski, Stefan
Saleem, Moin A.
Piwkowska, Agnieszka
author_facet Typiak, Marlena
Kulesza, Tomasz
Rachubik, Patrycja
Rogacka, Dorota
Audzeyenka, Irena
Angielski, Stefan
Saleem, Moin A.
Piwkowska, Agnieszka
author_sort Typiak, Marlena
collection PubMed
description Hyperglycemic conditions (HG), at early stages of diabetic nephropathy (DN), cause a decrease in podocyte numbers and an aberration of their function as key cells for glomerular plasma filtration. Klotho protein was shown to overcome some negative effects of hyperglycemia. Klotho is also a coreceptor for fibroblast growth factor receptors (FGFRs), the signaling of which, together with a proper rate of glycolysis in podocytes, is needed for a proper function of the glomerular filtration barrier. Therefore, we measured levels of Klotho in renal tissue, serum, and urine shortly after DN induction. We investigated whether it influences levels of FGFRs, rates of glycolysis in podocytes, and albumin permeability. During hyperglycemia, the level of membrane-bound Klotho in renal tissue decreased, with an increase in the shedding of soluble Klotho, its higher presence in serum, and lower urinary excretion. The addition of Klotho increased FGFR levels, especially FGFR1/FGFR2, after their HG-induced decrease. Klotho also increased levels of glycolytic parameters of podocytes, and decreased podocytic and glomerular albumin permeability in HG. Thus, we found that the decrease in the urinary excretion of Klotho might be an early biomarker of DN and that Klotho administration may have several beneficial effects on renal function in DN.
format Online
Article
Text
id pubmed-8345972
institution National Center for Biotechnology Information
language English
publishDate 2021
publisher MDPI
record_format MEDLINE/PubMed
spelling pubmed-83459722021-08-07 Role of Klotho in Hyperglycemia: Its Levels and Effects on Fibroblast Growth Factor Receptors, Glycolysis, and Glomerular Filtration Typiak, Marlena Kulesza, Tomasz Rachubik, Patrycja Rogacka, Dorota Audzeyenka, Irena Angielski, Stefan Saleem, Moin A. Piwkowska, Agnieszka Int J Mol Sci Article Hyperglycemic conditions (HG), at early stages of diabetic nephropathy (DN), cause a decrease in podocyte numbers and an aberration of their function as key cells for glomerular plasma filtration. Klotho protein was shown to overcome some negative effects of hyperglycemia. Klotho is also a coreceptor for fibroblast growth factor receptors (FGFRs), the signaling of which, together with a proper rate of glycolysis in podocytes, is needed for a proper function of the glomerular filtration barrier. Therefore, we measured levels of Klotho in renal tissue, serum, and urine shortly after DN induction. We investigated whether it influences levels of FGFRs, rates of glycolysis in podocytes, and albumin permeability. During hyperglycemia, the level of membrane-bound Klotho in renal tissue decreased, with an increase in the shedding of soluble Klotho, its higher presence in serum, and lower urinary excretion. The addition of Klotho increased FGFR levels, especially FGFR1/FGFR2, after their HG-induced decrease. Klotho also increased levels of glycolytic parameters of podocytes, and decreased podocytic and glomerular albumin permeability in HG. Thus, we found that the decrease in the urinary excretion of Klotho might be an early biomarker of DN and that Klotho administration may have several beneficial effects on renal function in DN. MDPI 2021-07-23 /pmc/articles/PMC8345972/ /pubmed/34360633 http://dx.doi.org/10.3390/ijms22157867 Text en © 2021 by the authors. https://creativecommons.org/licenses/by/4.0/Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/).
spellingShingle Article
Typiak, Marlena
Kulesza, Tomasz
Rachubik, Patrycja
Rogacka, Dorota
Audzeyenka, Irena
Angielski, Stefan
Saleem, Moin A.
Piwkowska, Agnieszka
Role of Klotho in Hyperglycemia: Its Levels and Effects on Fibroblast Growth Factor Receptors, Glycolysis, and Glomerular Filtration
title Role of Klotho in Hyperglycemia: Its Levels and Effects on Fibroblast Growth Factor Receptors, Glycolysis, and Glomerular Filtration
title_full Role of Klotho in Hyperglycemia: Its Levels and Effects on Fibroblast Growth Factor Receptors, Glycolysis, and Glomerular Filtration
title_fullStr Role of Klotho in Hyperglycemia: Its Levels and Effects on Fibroblast Growth Factor Receptors, Glycolysis, and Glomerular Filtration
title_full_unstemmed Role of Klotho in Hyperglycemia: Its Levels and Effects on Fibroblast Growth Factor Receptors, Glycolysis, and Glomerular Filtration
title_short Role of Klotho in Hyperglycemia: Its Levels and Effects on Fibroblast Growth Factor Receptors, Glycolysis, and Glomerular Filtration
title_sort role of klotho in hyperglycemia: its levels and effects on fibroblast growth factor receptors, glycolysis, and glomerular filtration
topic Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8345972/
https://www.ncbi.nlm.nih.gov/pubmed/34360633
http://dx.doi.org/10.3390/ijms22157867
work_keys_str_mv AT typiakmarlena roleofklothoinhyperglycemiaitslevelsandeffectsonfibroblastgrowthfactorreceptorsglycolysisandglomerularfiltration
AT kuleszatomasz roleofklothoinhyperglycemiaitslevelsandeffectsonfibroblastgrowthfactorreceptorsglycolysisandglomerularfiltration
AT rachubikpatrycja roleofklothoinhyperglycemiaitslevelsandeffectsonfibroblastgrowthfactorreceptorsglycolysisandglomerularfiltration
AT rogackadorota roleofklothoinhyperglycemiaitslevelsandeffectsonfibroblastgrowthfactorreceptorsglycolysisandglomerularfiltration
AT audzeyenkairena roleofklothoinhyperglycemiaitslevelsandeffectsonfibroblastgrowthfactorreceptorsglycolysisandglomerularfiltration
AT angielskistefan roleofklothoinhyperglycemiaitslevelsandeffectsonfibroblastgrowthfactorreceptorsglycolysisandglomerularfiltration
AT saleemmoina roleofklothoinhyperglycemiaitslevelsandeffectsonfibroblastgrowthfactorreceptorsglycolysisandglomerularfiltration
AT piwkowskaagnieszka roleofklothoinhyperglycemiaitslevelsandeffectsonfibroblastgrowthfactorreceptorsglycolysisandglomerularfiltration