Cargando…
The Problem of Abnormal Body Weight and Dyslipidemia as Risk Factors for Cardiovascular Diseases in Children and Adolescents with Type 1 Diabetes
Diabetes is a disease that affects many people around the world. Its complications are the cause of cardiovascular diseases (CVD) and increased mortality. That is why the search for predictive biomarkers is so important. The aim of the study was to show the prevalence of the problem and risk factors...
Autores principales: | , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Hindawi
2021
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8355997/ https://www.ncbi.nlm.nih.gov/pubmed/34395631 http://dx.doi.org/10.1155/2021/5555149 |
_version_ | 1783736862306729984 |
---|---|
author | Noras, Katarzyna Rusak, Ewa Jarosz-Chobot, Przemysława |
author_facet | Noras, Katarzyna Rusak, Ewa Jarosz-Chobot, Przemysława |
author_sort | Noras, Katarzyna |
collection | PubMed |
description | Diabetes is a disease that affects many people around the world. Its complications are the cause of cardiovascular diseases (CVD) and increased mortality. That is why the search for predictive biomarkers is so important. The aim of the study was to show the prevalence of the problem and risk factors in children and adolescents with type 1 diabetes. These patients are often overweight and obese, and the percentage of lipid disorders is particularly high. The discussed markers of CVD risk in type 1 diabetes include apolipoproteins (apo-B and apo-C3), modified forms of LDL, and the role of high-density lipoprotein (HDL). Recently, a new look at the vasoprotective effect of HDL has appeared, which due to its dysfunctional form in type 1 diabetes may not protect against cardiovascular risk. The HDL proteome in type 1 diabetes has an altered protein composition compared to the healthy population. Another direction of research is determining the importance of trace elements (mainly Mg) in the development of diabetes complications. |
format | Online Article Text |
id | pubmed-8355997 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2021 |
publisher | Hindawi |
record_format | MEDLINE/PubMed |
spelling | pubmed-83559972021-08-12 The Problem of Abnormal Body Weight and Dyslipidemia as Risk Factors for Cardiovascular Diseases in Children and Adolescents with Type 1 Diabetes Noras, Katarzyna Rusak, Ewa Jarosz-Chobot, Przemysława J Diabetes Res Review Article Diabetes is a disease that affects many people around the world. Its complications are the cause of cardiovascular diseases (CVD) and increased mortality. That is why the search for predictive biomarkers is so important. The aim of the study was to show the prevalence of the problem and risk factors in children and adolescents with type 1 diabetes. These patients are often overweight and obese, and the percentage of lipid disorders is particularly high. The discussed markers of CVD risk in type 1 diabetes include apolipoproteins (apo-B and apo-C3), modified forms of LDL, and the role of high-density lipoprotein (HDL). Recently, a new look at the vasoprotective effect of HDL has appeared, which due to its dysfunctional form in type 1 diabetes may not protect against cardiovascular risk. The HDL proteome in type 1 diabetes has an altered protein composition compared to the healthy population. Another direction of research is determining the importance of trace elements (mainly Mg) in the development of diabetes complications. Hindawi 2021-08-02 /pmc/articles/PMC8355997/ /pubmed/34395631 http://dx.doi.org/10.1155/2021/5555149 Text en Copyright © 2021 Katarzyna Noras et al. https://creativecommons.org/licenses/by/4.0/This is an open access article distributed under the Creative Commons Attribution License, which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited. |
spellingShingle | Review Article Noras, Katarzyna Rusak, Ewa Jarosz-Chobot, Przemysława The Problem of Abnormal Body Weight and Dyslipidemia as Risk Factors for Cardiovascular Diseases in Children and Adolescents with Type 1 Diabetes |
title | The Problem of Abnormal Body Weight and Dyslipidemia as Risk Factors for Cardiovascular Diseases in Children and Adolescents with Type 1 Diabetes |
title_full | The Problem of Abnormal Body Weight and Dyslipidemia as Risk Factors for Cardiovascular Diseases in Children and Adolescents with Type 1 Diabetes |
title_fullStr | The Problem of Abnormal Body Weight and Dyslipidemia as Risk Factors for Cardiovascular Diseases in Children and Adolescents with Type 1 Diabetes |
title_full_unstemmed | The Problem of Abnormal Body Weight and Dyslipidemia as Risk Factors for Cardiovascular Diseases in Children and Adolescents with Type 1 Diabetes |
title_short | The Problem of Abnormal Body Weight and Dyslipidemia as Risk Factors for Cardiovascular Diseases in Children and Adolescents with Type 1 Diabetes |
title_sort | problem of abnormal body weight and dyslipidemia as risk factors for cardiovascular diseases in children and adolescents with type 1 diabetes |
topic | Review Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8355997/ https://www.ncbi.nlm.nih.gov/pubmed/34395631 http://dx.doi.org/10.1155/2021/5555149 |
work_keys_str_mv | AT noraskatarzyna theproblemofabnormalbodyweightanddyslipidemiaasriskfactorsforcardiovasculardiseasesinchildrenandadolescentswithtype1diabetes AT rusakewa theproblemofabnormalbodyweightanddyslipidemiaasriskfactorsforcardiovasculardiseasesinchildrenandadolescentswithtype1diabetes AT jaroszchobotprzemysława theproblemofabnormalbodyweightanddyslipidemiaasriskfactorsforcardiovasculardiseasesinchildrenandadolescentswithtype1diabetes AT noraskatarzyna problemofabnormalbodyweightanddyslipidemiaasriskfactorsforcardiovasculardiseasesinchildrenandadolescentswithtype1diabetes AT rusakewa problemofabnormalbodyweightanddyslipidemiaasriskfactorsforcardiovasculardiseasesinchildrenandadolescentswithtype1diabetes AT jaroszchobotprzemysława problemofabnormalbodyweightanddyslipidemiaasriskfactorsforcardiovasculardiseasesinchildrenandadolescentswithtype1diabetes |