Cargando…
Case Report: Novel Biallelic Mutations in ARMC4 Cause Primary Ciliary Dyskinesia and Male Infertility in a Chinese Family
Primary ciliary dyskinesia (PCD) is a clinically and genetically heterogeneous ciliopathy affecting the cilia and sperm flagella. Mutations in genes related to the structural and functional defects of respiratory ciliary axoneme have been reported to be the predominant cause of this symptom; however...
Autores principales: | , , , , , , , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Frontiers Media S.A.
2021
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8362595/ https://www.ncbi.nlm.nih.gov/pubmed/34394199 http://dx.doi.org/10.3389/fgene.2021.715339 |
_version_ | 1783738198359277568 |
---|---|
author | Gao, Yang Xu, Chuan Tan, Qing Shen, Qunshan Wu, Huan Lv, Mingrong Li, Kuokuo Tang, Dongdong Song, Bing Xu, Yuping Zhou, Ping Wei, Zhaolian Tao, Fangbiao Cao, Yunxia He, Xiaojin |
author_facet | Gao, Yang Xu, Chuan Tan, Qing Shen, Qunshan Wu, Huan Lv, Mingrong Li, Kuokuo Tang, Dongdong Song, Bing Xu, Yuping Zhou, Ping Wei, Zhaolian Tao, Fangbiao Cao, Yunxia He, Xiaojin |
author_sort | Gao, Yang |
collection | PubMed |
description | Primary ciliary dyskinesia (PCD) is a clinically and genetically heterogeneous ciliopathy affecting the cilia and sperm flagella. Mutations in genes related to the structural and functional defects of respiratory ciliary axoneme have been reported to be the predominant cause of this symptom; however, evidence regarding male infertility and genotype–phenotype associations between some of these genes and flagellar axoneme remains unclear. Here, we reported a male patient from a non-consanguineous Chinese family who exhibited left/right body asymmetry and oligoasthenoterazoospermia factor infertility. Novel compound heterozygous mutations in ARMC4 (NM:018076: c.2095C>T: p. Gln699(*); c.1679C>T: p. Ala560Val) were identified in this patient, and his parents were a heterozygous carrier for the mutations. Morphological and ultrastructural analysis of the spermatozoa from the man showed aberrant sperm flagella with axonemal disorganization and outer dynein arm (ODA) loss. In addition, immunofluorescence analysis of the spermatozoa from the proband and a control man revealed a significant lower expression of ARMC4 protein due to pathogenic mutations. Therefore, our findings help to expand the spectrum of ARMC4 pathogenic mutations and linked biallelic ARMC4 mutations to male infertility for the first time. |
format | Online Article Text |
id | pubmed-8362595 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2021 |
publisher | Frontiers Media S.A. |
record_format | MEDLINE/PubMed |
spelling | pubmed-83625952021-08-14 Case Report: Novel Biallelic Mutations in ARMC4 Cause Primary Ciliary Dyskinesia and Male Infertility in a Chinese Family Gao, Yang Xu, Chuan Tan, Qing Shen, Qunshan Wu, Huan Lv, Mingrong Li, Kuokuo Tang, Dongdong Song, Bing Xu, Yuping Zhou, Ping Wei, Zhaolian Tao, Fangbiao Cao, Yunxia He, Xiaojin Front Genet Genetics Primary ciliary dyskinesia (PCD) is a clinically and genetically heterogeneous ciliopathy affecting the cilia and sperm flagella. Mutations in genes related to the structural and functional defects of respiratory ciliary axoneme have been reported to be the predominant cause of this symptom; however, evidence regarding male infertility and genotype–phenotype associations between some of these genes and flagellar axoneme remains unclear. Here, we reported a male patient from a non-consanguineous Chinese family who exhibited left/right body asymmetry and oligoasthenoterazoospermia factor infertility. Novel compound heterozygous mutations in ARMC4 (NM:018076: c.2095C>T: p. Gln699(*); c.1679C>T: p. Ala560Val) were identified in this patient, and his parents were a heterozygous carrier for the mutations. Morphological and ultrastructural analysis of the spermatozoa from the man showed aberrant sperm flagella with axonemal disorganization and outer dynein arm (ODA) loss. In addition, immunofluorescence analysis of the spermatozoa from the proband and a control man revealed a significant lower expression of ARMC4 protein due to pathogenic mutations. Therefore, our findings help to expand the spectrum of ARMC4 pathogenic mutations and linked biallelic ARMC4 mutations to male infertility for the first time. Frontiers Media S.A. 2021-07-30 /pmc/articles/PMC8362595/ /pubmed/34394199 http://dx.doi.org/10.3389/fgene.2021.715339 Text en Copyright © 2021 Gao, Xu, Tan, Shen, Wu, Lv, Li, Tang, Song, Xu, Zhou, Wei, Tao, Cao and He. https://creativecommons.org/licenses/by/4.0/This is an open-access article distributed under the terms of the Creative Commons Attribution License (CC BY). The use, distribution or reproduction in other forums is permitted, provided the original author(s) and the copyright owner(s) are credited and that the original publication in this journal is cited, in accordance with accepted academic practice. No use, distribution or reproduction is permitted which does not comply with these terms. |
spellingShingle | Genetics Gao, Yang Xu, Chuan Tan, Qing Shen, Qunshan Wu, Huan Lv, Mingrong Li, Kuokuo Tang, Dongdong Song, Bing Xu, Yuping Zhou, Ping Wei, Zhaolian Tao, Fangbiao Cao, Yunxia He, Xiaojin Case Report: Novel Biallelic Mutations in ARMC4 Cause Primary Ciliary Dyskinesia and Male Infertility in a Chinese Family |
title | Case Report: Novel Biallelic Mutations in ARMC4 Cause Primary Ciliary Dyskinesia and Male Infertility in a Chinese Family |
title_full | Case Report: Novel Biallelic Mutations in ARMC4 Cause Primary Ciliary Dyskinesia and Male Infertility in a Chinese Family |
title_fullStr | Case Report: Novel Biallelic Mutations in ARMC4 Cause Primary Ciliary Dyskinesia and Male Infertility in a Chinese Family |
title_full_unstemmed | Case Report: Novel Biallelic Mutations in ARMC4 Cause Primary Ciliary Dyskinesia and Male Infertility in a Chinese Family |
title_short | Case Report: Novel Biallelic Mutations in ARMC4 Cause Primary Ciliary Dyskinesia and Male Infertility in a Chinese Family |
title_sort | case report: novel biallelic mutations in armc4 cause primary ciliary dyskinesia and male infertility in a chinese family |
topic | Genetics |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8362595/ https://www.ncbi.nlm.nih.gov/pubmed/34394199 http://dx.doi.org/10.3389/fgene.2021.715339 |
work_keys_str_mv | AT gaoyang casereportnovelbiallelicmutationsinarmc4causeprimaryciliarydyskinesiaandmaleinfertilityinachinesefamily AT xuchuan casereportnovelbiallelicmutationsinarmc4causeprimaryciliarydyskinesiaandmaleinfertilityinachinesefamily AT tanqing casereportnovelbiallelicmutationsinarmc4causeprimaryciliarydyskinesiaandmaleinfertilityinachinesefamily AT shenqunshan casereportnovelbiallelicmutationsinarmc4causeprimaryciliarydyskinesiaandmaleinfertilityinachinesefamily AT wuhuan casereportnovelbiallelicmutationsinarmc4causeprimaryciliarydyskinesiaandmaleinfertilityinachinesefamily AT lvmingrong casereportnovelbiallelicmutationsinarmc4causeprimaryciliarydyskinesiaandmaleinfertilityinachinesefamily AT likuokuo casereportnovelbiallelicmutationsinarmc4causeprimaryciliarydyskinesiaandmaleinfertilityinachinesefamily AT tangdongdong casereportnovelbiallelicmutationsinarmc4causeprimaryciliarydyskinesiaandmaleinfertilityinachinesefamily AT songbing casereportnovelbiallelicmutationsinarmc4causeprimaryciliarydyskinesiaandmaleinfertilityinachinesefamily AT xuyuping casereportnovelbiallelicmutationsinarmc4causeprimaryciliarydyskinesiaandmaleinfertilityinachinesefamily AT zhouping casereportnovelbiallelicmutationsinarmc4causeprimaryciliarydyskinesiaandmaleinfertilityinachinesefamily AT weizhaolian casereportnovelbiallelicmutationsinarmc4causeprimaryciliarydyskinesiaandmaleinfertilityinachinesefamily AT taofangbiao casereportnovelbiallelicmutationsinarmc4causeprimaryciliarydyskinesiaandmaleinfertilityinachinesefamily AT caoyunxia casereportnovelbiallelicmutationsinarmc4causeprimaryciliarydyskinesiaandmaleinfertilityinachinesefamily AT hexiaojin casereportnovelbiallelicmutationsinarmc4causeprimaryciliarydyskinesiaandmaleinfertilityinachinesefamily |