Cargando…
Coronavirus disease and male fertility: a systematic review
BACKGROUND: Based on the information from other SARS-CoV infections in the patients recovered from COVID-19, particularly cases in the reproductive age, gonadal function evaluation and andrological consultation comprising semen analysis are recommended. MAIN BODY: Based on the COVID-19 infected pati...
Autores principales: | , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Springer Berlin Heidelberg
2021
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8365281/ https://www.ncbi.nlm.nih.gov/pubmed/34421291 http://dx.doi.org/10.1186/s43043-021-00073-4 |
_version_ | 1783738676046462976 |
---|---|
author | Fathi, Mobina Vakili, Kimia Aliaghaei, Abbas Nematollahi, Shahrzad Peirouvi, Tahmineh Shalizar-Jalali, Ali |
author_facet | Fathi, Mobina Vakili, Kimia Aliaghaei, Abbas Nematollahi, Shahrzad Peirouvi, Tahmineh Shalizar-Jalali, Ali |
author_sort | Fathi, Mobina |
collection | PubMed |
description | BACKGROUND: Based on the information from other SARS-CoV infections in the patients recovered from COVID-19, particularly cases in the reproductive age, gonadal function evaluation and andrological consultation comprising semen analysis are recommended. MAIN BODY: Based on the COVID-19 infected patients’ seminal fluid analyses, SARS-CoV-2 may employ the male reproductive system as a transmission pathway. It has been also demonstrated that angiotensin-converting enzyme 2 (ACE2) can be strongly expressed at the protein levels in the testicular cells. The high expression of ACE2 in testes suggests that testes in the COVID-19 infected males can have an important role in the viral persistence and this subject needs further investigations. Several researchers have examined males recovered from COVID-19, but still, large-scale experiments are needed to determine the effects of SARS-CoV-2 on the male reproductive system as well as viral transmission risk. CONCLUSION: Comprehensive researches are required to figure out the presence of the SARS-CoV-2 virus in seminal fluid as well as its sexual transmissibility and impact on sperm characteristics. |
format | Online Article Text |
id | pubmed-8365281 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2021 |
publisher | Springer Berlin Heidelberg |
record_format | MEDLINE/PubMed |
spelling | pubmed-83652812021-08-16 Coronavirus disease and male fertility: a systematic review Fathi, Mobina Vakili, Kimia Aliaghaei, Abbas Nematollahi, Shahrzad Peirouvi, Tahmineh Shalizar-Jalali, Ali Middle East Fertil Soc J Review BACKGROUND: Based on the information from other SARS-CoV infections in the patients recovered from COVID-19, particularly cases in the reproductive age, gonadal function evaluation and andrological consultation comprising semen analysis are recommended. MAIN BODY: Based on the COVID-19 infected patients’ seminal fluid analyses, SARS-CoV-2 may employ the male reproductive system as a transmission pathway. It has been also demonstrated that angiotensin-converting enzyme 2 (ACE2) can be strongly expressed at the protein levels in the testicular cells. The high expression of ACE2 in testes suggests that testes in the COVID-19 infected males can have an important role in the viral persistence and this subject needs further investigations. Several researchers have examined males recovered from COVID-19, but still, large-scale experiments are needed to determine the effects of SARS-CoV-2 on the male reproductive system as well as viral transmission risk. CONCLUSION: Comprehensive researches are required to figure out the presence of the SARS-CoV-2 virus in seminal fluid as well as its sexual transmissibility and impact on sperm characteristics. Springer Berlin Heidelberg 2021-08-16 2021 /pmc/articles/PMC8365281/ /pubmed/34421291 http://dx.doi.org/10.1186/s43043-021-00073-4 Text en © The Author(s) 2021 https://creativecommons.org/licenses/by/4.0/Open AccessThis article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/ (https://creativecommons.org/licenses/by/4.0/) . |
spellingShingle | Review Fathi, Mobina Vakili, Kimia Aliaghaei, Abbas Nematollahi, Shahrzad Peirouvi, Tahmineh Shalizar-Jalali, Ali Coronavirus disease and male fertility: a systematic review |
title | Coronavirus disease and male fertility: a systematic review |
title_full | Coronavirus disease and male fertility: a systematic review |
title_fullStr | Coronavirus disease and male fertility: a systematic review |
title_full_unstemmed | Coronavirus disease and male fertility: a systematic review |
title_short | Coronavirus disease and male fertility: a systematic review |
title_sort | coronavirus disease and male fertility: a systematic review |
topic | Review |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8365281/ https://www.ncbi.nlm.nih.gov/pubmed/34421291 http://dx.doi.org/10.1186/s43043-021-00073-4 |
work_keys_str_mv | AT fathimobina coronavirusdiseaseandmalefertilityasystematicreview AT vakilikimia coronavirusdiseaseandmalefertilityasystematicreview AT aliaghaeiabbas coronavirusdiseaseandmalefertilityasystematicreview AT nematollahishahrzad coronavirusdiseaseandmalefertilityasystematicreview AT peirouvitahmineh coronavirusdiseaseandmalefertilityasystematicreview AT shalizarjalaliali coronavirusdiseaseandmalefertilityasystematicreview |