Cargando…
Preparation of siRNA–PLGA/Fabʹ–PLGA mixed micellar system with target cell-specific recognition
Small interfering RNAs (siRNAs) are susceptible to nucleases and degrade quickly in vivo. Moreover, siRNAs demonstrate poor cellular uptake and cannot cross the cell membrane because of its polyanionic characteristics. To overcome these challenges, an intelligent gene delivery system that protects s...
Autores principales: | , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Nature Publishing Group UK
2021
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8373956/ https://www.ncbi.nlm.nih.gov/pubmed/34408228 http://dx.doi.org/10.1038/s41598-021-96245-3 |
_version_ | 1783740015731277824 |
---|---|
author | Hazekawa, Mai Nishinakagawa, Takuya Mori, Takeshi Yoshida, Miyako Uchida, Takahiro Ishibashi, Daisuke |
author_facet | Hazekawa, Mai Nishinakagawa, Takuya Mori, Takeshi Yoshida, Miyako Uchida, Takahiro Ishibashi, Daisuke |
author_sort | Hazekawa, Mai |
collection | PubMed |
description | Small interfering RNAs (siRNAs) are susceptible to nucleases and degrade quickly in vivo. Moreover, siRNAs demonstrate poor cellular uptake and cannot cross the cell membrane because of its polyanionic characteristics. To overcome these challenges, an intelligent gene delivery system that protects siRNAs from nucleases and facilitates siRNA cellular uptake is required. We previously reported the potential of siRNA-poly(d,l-lactic-co-glycolic acid; PLGA) micelles as an effective siRNA delivery tool in a murine peritoneal dissemination model by local injection. However, there was no effective formulation for siRNA delivery to target cells via intravenous injection. This study aimed to prepare siRNA–PLGA/Fabʹ–PLGA mixed micelles for siRNA delivery to target floating cells and evaluate its formulation in vitro. As the target siRNA protein in CEMx174, CyclinB1 levels were significantly reduced when siRNA–PLGA/Fabʹ–PLGA mixed micelles were added to cells compared with siRNA–PLGA micelles. siRNA–PLGA/Fabʹ–PLGA mixed micelles have high cell permeability and high target cell accumulation by endocytosis because flow cytometry detected labeling micelles in target cells. This study supports siRNA–PLGA/Fabʹ–PLGA mixed micelles as an effective siRNA delivery tool. This formulation can be administered systemically in dosage form against target cells, including cancer metastasis or blood cancer. |
format | Online Article Text |
id | pubmed-8373956 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2021 |
publisher | Nature Publishing Group UK |
record_format | MEDLINE/PubMed |
spelling | pubmed-83739562021-08-20 Preparation of siRNA–PLGA/Fabʹ–PLGA mixed micellar system with target cell-specific recognition Hazekawa, Mai Nishinakagawa, Takuya Mori, Takeshi Yoshida, Miyako Uchida, Takahiro Ishibashi, Daisuke Sci Rep Article Small interfering RNAs (siRNAs) are susceptible to nucleases and degrade quickly in vivo. Moreover, siRNAs demonstrate poor cellular uptake and cannot cross the cell membrane because of its polyanionic characteristics. To overcome these challenges, an intelligent gene delivery system that protects siRNAs from nucleases and facilitates siRNA cellular uptake is required. We previously reported the potential of siRNA-poly(d,l-lactic-co-glycolic acid; PLGA) micelles as an effective siRNA delivery tool in a murine peritoneal dissemination model by local injection. However, there was no effective formulation for siRNA delivery to target cells via intravenous injection. This study aimed to prepare siRNA–PLGA/Fabʹ–PLGA mixed micelles for siRNA delivery to target floating cells and evaluate its formulation in vitro. As the target siRNA protein in CEMx174, CyclinB1 levels were significantly reduced when siRNA–PLGA/Fabʹ–PLGA mixed micelles were added to cells compared with siRNA–PLGA micelles. siRNA–PLGA/Fabʹ–PLGA mixed micelles have high cell permeability and high target cell accumulation by endocytosis because flow cytometry detected labeling micelles in target cells. This study supports siRNA–PLGA/Fabʹ–PLGA mixed micelles as an effective siRNA delivery tool. This formulation can be administered systemically in dosage form against target cells, including cancer metastasis or blood cancer. Nature Publishing Group UK 2021-08-18 /pmc/articles/PMC8373956/ /pubmed/34408228 http://dx.doi.org/10.1038/s41598-021-96245-3 Text en © The Author(s) 2021 https://creativecommons.org/licenses/by/4.0/Open Access This article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/ (https://creativecommons.org/licenses/by/4.0/) . |
spellingShingle | Article Hazekawa, Mai Nishinakagawa, Takuya Mori, Takeshi Yoshida, Miyako Uchida, Takahiro Ishibashi, Daisuke Preparation of siRNA–PLGA/Fabʹ–PLGA mixed micellar system with target cell-specific recognition |
title | Preparation of siRNA–PLGA/Fabʹ–PLGA mixed micellar system with target cell-specific recognition |
title_full | Preparation of siRNA–PLGA/Fabʹ–PLGA mixed micellar system with target cell-specific recognition |
title_fullStr | Preparation of siRNA–PLGA/Fabʹ–PLGA mixed micellar system with target cell-specific recognition |
title_full_unstemmed | Preparation of siRNA–PLGA/Fabʹ–PLGA mixed micellar system with target cell-specific recognition |
title_short | Preparation of siRNA–PLGA/Fabʹ–PLGA mixed micellar system with target cell-specific recognition |
title_sort | preparation of sirna–plga/fabʹ–plga mixed micellar system with target cell-specific recognition |
topic | Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8373956/ https://www.ncbi.nlm.nih.gov/pubmed/34408228 http://dx.doi.org/10.1038/s41598-021-96245-3 |
work_keys_str_mv | AT hazekawamai preparationofsirnaplgafabʹplgamixedmicellarsystemwithtargetcellspecificrecognition AT nishinakagawatakuya preparationofsirnaplgafabʹplgamixedmicellarsystemwithtargetcellspecificrecognition AT moritakeshi preparationofsirnaplgafabʹplgamixedmicellarsystemwithtargetcellspecificrecognition AT yoshidamiyako preparationofsirnaplgafabʹplgamixedmicellarsystemwithtargetcellspecificrecognition AT uchidatakahiro preparationofsirnaplgafabʹplgamixedmicellarsystemwithtargetcellspecificrecognition AT ishibashidaisuke preparationofsirnaplgafabʹplgamixedmicellarsystemwithtargetcellspecificrecognition |