Cargando…
Vesicle trafficking and pathways to neurodegeneration
| Autores principales: | , , , |
|---|---|
| Formato: | Online Artículo Texto |
| Lenguaje: | English |
| Publicado: |
BioMed Central
2021
|
| Materias: | |
| Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8379594/ https://www.ncbi.nlm.nih.gov/pubmed/34419119 http://dx.doi.org/10.1186/s13024-021-00480-1 |
| _version_ | 1783741038712586240 |
|---|---|
| author | Blackstone, Craig Elwood, Fiona Plun-Favreau, Helene Lewis, Patrick A. |
| author_facet | Blackstone, Craig Elwood, Fiona Plun-Favreau, Helene Lewis, Patrick A. |
| author_sort | Blackstone, Craig |
| collection | PubMed |
| description | |
| format | Online Article Text |
| id | pubmed-8379594 |
| institution | National Center for Biotechnology Information |
| language | English |
| publishDate | 2021 |
| publisher | BioMed Central |
| record_format | MEDLINE/PubMed |
| spelling | pubmed-83795942021-08-23 Vesicle trafficking and pathways to neurodegeneration Blackstone, Craig Elwood, Fiona Plun-Favreau, Helene Lewis, Patrick A. Mol Neurodegener Meeting Report BioMed Central 2021-08-21 /pmc/articles/PMC8379594/ /pubmed/34419119 http://dx.doi.org/10.1186/s13024-021-00480-1 Text en © The Author(s) 2021 https://creativecommons.org/licenses/by/4.0/Open AccessThis article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/ (https://creativecommons.org/licenses/by/4.0/) . The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/ (https://creativecommons.org/publicdomain/zero/1.0/) ) applies to the data made available in this article, unless otherwise stated in a credit line to the data. |
| spellingShingle | Meeting Report Blackstone, Craig Elwood, Fiona Plun-Favreau, Helene Lewis, Patrick A. Vesicle trafficking and pathways to neurodegeneration |
| title | Vesicle trafficking and pathways to neurodegeneration |
| title_full | Vesicle trafficking and pathways to neurodegeneration |
| title_fullStr | Vesicle trafficking and pathways to neurodegeneration |
| title_full_unstemmed | Vesicle trafficking and pathways to neurodegeneration |
| title_short | Vesicle trafficking and pathways to neurodegeneration |
| title_sort | vesicle trafficking and pathways to neurodegeneration |
| topic | Meeting Report |
| url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8379594/ https://www.ncbi.nlm.nih.gov/pubmed/34419119 http://dx.doi.org/10.1186/s13024-021-00480-1 |
| work_keys_str_mv | AT blackstonecraig vesicletraffickingandpathwaystoneurodegeneration AT elwoodfiona vesicletraffickingandpathwaystoneurodegeneration AT plunfavreauhelene vesicletraffickingandpathwaystoneurodegeneration AT lewispatricka vesicletraffickingandpathwaystoneurodegeneration |