Cargando…
The “Climb” Towards Minimal Disease Activity in Psoriatic Arthritis
INTRODUCTION: Minimal disease activity (MDA) is a validated outcome measure in psoriatic arthritis (PsA) defining a low disease activity state with a cutoff of 5/7. The main aim of the study was to look at the MDA divided into in the seven cutoffs, analyzing the more frequently achieved domains. The...
Autores principales: | , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Springer Healthcare
2021
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8380617/ https://www.ncbi.nlm.nih.gov/pubmed/34302631 http://dx.doi.org/10.1007/s40744-021-00343-7 |
_version_ | 1783741233657544704 |
---|---|
author | Lubrano, Ennio Scriffignano, Silvia Perrotta, Fabio Massimo |
author_facet | Lubrano, Ennio Scriffignano, Silvia Perrotta, Fabio Massimo |
author_sort | Lubrano, Ennio |
collection | PubMed |
description | INTRODUCTION: Minimal disease activity (MDA) is a validated outcome measure in psoriatic arthritis (PsA) defining a low disease activity state with a cutoff of 5/7. The main aim of the study was to look at the MDA divided into in the seven cutoffs, analyzing the more frequently achieved domains. The relationship between MDA, PASS, PsAID, DAPSA, and the PhGA in all cutoffs was also evaluated. METHODS: Cross-sectional analysis on PsA patients satisfying CASPAR criteria. An assessment of disease activity, treatment target, function, and impact of disease was performed. Patients achieving MDA were compared to patients not achieving MDA in order to evaluate the most frequent domain found. RESULTS: Ninety-three PsA patients were enrolled. MDA was satisfied in 44/93, while in 47 MDA ranged from 1/7 to 4/7. Among the seven domains, Leeds Enthesitis Index (LEI) was the most frequent domain found in all patients. In those not in MDA, BSA ≤ 3 (70%) and swollen joints count ≤ 1 (68%) were also well represented. The domains with a lower percentage of patients not in MDA were HAQ-DI ≤ 0.5 (38.8%), tender joint count ≤ 1 (23%), PtGA ≤ 20 (4.2%) and VAS pain ≤ 15 mm (2%). There was a growing trend, from MDA 1/7 to MDA 7/7 in the percentage of patients in PASS yes, in PsAID ≤ 4, and in DAPSA ≤ 14. CONCLUSIONS: The present study detailed the domains more achieved also in those patients not in MDA showing that “physician-driven” domains are more frequently achieved in our patients. |
format | Online Article Text |
id | pubmed-8380617 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2021 |
publisher | Springer Healthcare |
record_format | MEDLINE/PubMed |
spelling | pubmed-83806172021-09-08 The “Climb” Towards Minimal Disease Activity in Psoriatic Arthritis Lubrano, Ennio Scriffignano, Silvia Perrotta, Fabio Massimo Rheumatol Ther Brief Report INTRODUCTION: Minimal disease activity (MDA) is a validated outcome measure in psoriatic arthritis (PsA) defining a low disease activity state with a cutoff of 5/7. The main aim of the study was to look at the MDA divided into in the seven cutoffs, analyzing the more frequently achieved domains. The relationship between MDA, PASS, PsAID, DAPSA, and the PhGA in all cutoffs was also evaluated. METHODS: Cross-sectional analysis on PsA patients satisfying CASPAR criteria. An assessment of disease activity, treatment target, function, and impact of disease was performed. Patients achieving MDA were compared to patients not achieving MDA in order to evaluate the most frequent domain found. RESULTS: Ninety-three PsA patients were enrolled. MDA was satisfied in 44/93, while in 47 MDA ranged from 1/7 to 4/7. Among the seven domains, Leeds Enthesitis Index (LEI) was the most frequent domain found in all patients. In those not in MDA, BSA ≤ 3 (70%) and swollen joints count ≤ 1 (68%) were also well represented. The domains with a lower percentage of patients not in MDA were HAQ-DI ≤ 0.5 (38.8%), tender joint count ≤ 1 (23%), PtGA ≤ 20 (4.2%) and VAS pain ≤ 15 mm (2%). There was a growing trend, from MDA 1/7 to MDA 7/7 in the percentage of patients in PASS yes, in PsAID ≤ 4, and in DAPSA ≤ 14. CONCLUSIONS: The present study detailed the domains more achieved also in those patients not in MDA showing that “physician-driven” domains are more frequently achieved in our patients. Springer Healthcare 2021-07-24 /pmc/articles/PMC8380617/ /pubmed/34302631 http://dx.doi.org/10.1007/s40744-021-00343-7 Text en © The Author(s) 2021 https://creativecommons.org/licenses/by-nc/4.0/Open Access This article is licensed under a Creative Commons Attribution-NonCommercial 4.0 International License, which permits any non-commercial use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by-nc/4.0/ (https://creativecommons.org/licenses/by-nc/4.0/) . |
spellingShingle | Brief Report Lubrano, Ennio Scriffignano, Silvia Perrotta, Fabio Massimo The “Climb” Towards Minimal Disease Activity in Psoriatic Arthritis |
title | The “Climb” Towards Minimal Disease Activity in Psoriatic Arthritis |
title_full | The “Climb” Towards Minimal Disease Activity in Psoriatic Arthritis |
title_fullStr | The “Climb” Towards Minimal Disease Activity in Psoriatic Arthritis |
title_full_unstemmed | The “Climb” Towards Minimal Disease Activity in Psoriatic Arthritis |
title_short | The “Climb” Towards Minimal Disease Activity in Psoriatic Arthritis |
title_sort | “climb” towards minimal disease activity in psoriatic arthritis |
topic | Brief Report |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8380617/ https://www.ncbi.nlm.nih.gov/pubmed/34302631 http://dx.doi.org/10.1007/s40744-021-00343-7 |
work_keys_str_mv | AT lubranoennio theclimbtowardsminimaldiseaseactivityinpsoriaticarthritis AT scriffignanosilvia theclimbtowardsminimaldiseaseactivityinpsoriaticarthritis AT perrottafabiomassimo theclimbtowardsminimaldiseaseactivityinpsoriaticarthritis AT lubranoennio climbtowardsminimaldiseaseactivityinpsoriaticarthritis AT scriffignanosilvia climbtowardsminimaldiseaseactivityinpsoriaticarthritis AT perrottafabiomassimo climbtowardsminimaldiseaseactivityinpsoriaticarthritis |