Cargando…

The “Climb” Towards Minimal Disease Activity in Psoriatic Arthritis

INTRODUCTION: Minimal disease activity (MDA) is a validated outcome measure in psoriatic arthritis (PsA) defining a low disease activity state with a cutoff of 5/7. The main aim of the study was to look at the MDA divided into in the seven cutoffs, analyzing the more frequently achieved domains. The...

Descripción completa

Detalles Bibliográficos
Autores principales: Lubrano, Ennio, Scriffignano, Silvia, Perrotta, Fabio Massimo
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Springer Healthcare 2021
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8380617/
https://www.ncbi.nlm.nih.gov/pubmed/34302631
http://dx.doi.org/10.1007/s40744-021-00343-7
_version_ 1783741233657544704
author Lubrano, Ennio
Scriffignano, Silvia
Perrotta, Fabio Massimo
author_facet Lubrano, Ennio
Scriffignano, Silvia
Perrotta, Fabio Massimo
author_sort Lubrano, Ennio
collection PubMed
description INTRODUCTION: Minimal disease activity (MDA) is a validated outcome measure in psoriatic arthritis (PsA) defining a low disease activity state with a cutoff of 5/7. The main aim of the study was to look at the MDA divided into in the seven cutoffs, analyzing the more frequently achieved domains. The relationship between MDA, PASS, PsAID, DAPSA, and the PhGA in all cutoffs was also evaluated. METHODS: Cross-sectional analysis on PsA patients satisfying CASPAR criteria. An assessment of disease activity, treatment target, function, and impact of disease was performed. Patients achieving MDA were compared to patients not achieving MDA in order to evaluate the most frequent domain found. RESULTS: Ninety-three PsA patients were enrolled. MDA was satisfied in 44/93, while in 47 MDA ranged from 1/7 to 4/7. Among the seven domains, Leeds Enthesitis Index (LEI) was the most frequent domain found in all patients. In those not in MDA, BSA ≤ 3 (70%) and swollen joints count ≤ 1 (68%) were also well represented. The domains with a lower percentage of patients not in MDA were HAQ-DI ≤ 0.5 (38.8%), tender joint count ≤ 1 (23%), PtGA ≤ 20 (4.2%) and VAS pain ≤ 15 mm (2%). There was a growing trend, from MDA 1/7 to MDA 7/7 in the percentage of patients in PASS yes, in PsAID ≤ 4, and in DAPSA ≤ 14. CONCLUSIONS: The present study detailed the domains more achieved also in those patients not in MDA showing that “physician-driven” domains are more frequently achieved in our patients.
format Online
Article
Text
id pubmed-8380617
institution National Center for Biotechnology Information
language English
publishDate 2021
publisher Springer Healthcare
record_format MEDLINE/PubMed
spelling pubmed-83806172021-09-08 The “Climb” Towards Minimal Disease Activity in Psoriatic Arthritis Lubrano, Ennio Scriffignano, Silvia Perrotta, Fabio Massimo Rheumatol Ther Brief Report INTRODUCTION: Minimal disease activity (MDA) is a validated outcome measure in psoriatic arthritis (PsA) defining a low disease activity state with a cutoff of 5/7. The main aim of the study was to look at the MDA divided into in the seven cutoffs, analyzing the more frequently achieved domains. The relationship between MDA, PASS, PsAID, DAPSA, and the PhGA in all cutoffs was also evaluated. METHODS: Cross-sectional analysis on PsA patients satisfying CASPAR criteria. An assessment of disease activity, treatment target, function, and impact of disease was performed. Patients achieving MDA were compared to patients not achieving MDA in order to evaluate the most frequent domain found. RESULTS: Ninety-three PsA patients were enrolled. MDA was satisfied in 44/93, while in 47 MDA ranged from 1/7 to 4/7. Among the seven domains, Leeds Enthesitis Index (LEI) was the most frequent domain found in all patients. In those not in MDA, BSA ≤ 3 (70%) and swollen joints count ≤ 1 (68%) were also well represented. The domains with a lower percentage of patients not in MDA were HAQ-DI ≤ 0.5 (38.8%), tender joint count ≤ 1 (23%), PtGA ≤ 20 (4.2%) and VAS pain ≤ 15 mm (2%). There was a growing trend, from MDA 1/7 to MDA 7/7 in the percentage of patients in PASS yes, in PsAID ≤ 4, and in DAPSA ≤ 14. CONCLUSIONS: The present study detailed the domains more achieved also in those patients not in MDA showing that “physician-driven” domains are more frequently achieved in our patients. Springer Healthcare 2021-07-24 /pmc/articles/PMC8380617/ /pubmed/34302631 http://dx.doi.org/10.1007/s40744-021-00343-7 Text en © The Author(s) 2021 https://creativecommons.org/licenses/by-nc/4.0/Open Access This article is licensed under a Creative Commons Attribution-NonCommercial 4.0 International License, which permits any non-commercial use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by-nc/4.0/ (https://creativecommons.org/licenses/by-nc/4.0/) .
spellingShingle Brief Report
Lubrano, Ennio
Scriffignano, Silvia
Perrotta, Fabio Massimo
The “Climb” Towards Minimal Disease Activity in Psoriatic Arthritis
title The “Climb” Towards Minimal Disease Activity in Psoriatic Arthritis
title_full The “Climb” Towards Minimal Disease Activity in Psoriatic Arthritis
title_fullStr The “Climb” Towards Minimal Disease Activity in Psoriatic Arthritis
title_full_unstemmed The “Climb” Towards Minimal Disease Activity in Psoriatic Arthritis
title_short The “Climb” Towards Minimal Disease Activity in Psoriatic Arthritis
title_sort “climb” towards minimal disease activity in psoriatic arthritis
topic Brief Report
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8380617/
https://www.ncbi.nlm.nih.gov/pubmed/34302631
http://dx.doi.org/10.1007/s40744-021-00343-7
work_keys_str_mv AT lubranoennio theclimbtowardsminimaldiseaseactivityinpsoriaticarthritis
AT scriffignanosilvia theclimbtowardsminimaldiseaseactivityinpsoriaticarthritis
AT perrottafabiomassimo theclimbtowardsminimaldiseaseactivityinpsoriaticarthritis
AT lubranoennio climbtowardsminimaldiseaseactivityinpsoriaticarthritis
AT scriffignanosilvia climbtowardsminimaldiseaseactivityinpsoriaticarthritis
AT perrottafabiomassimo climbtowardsminimaldiseaseactivityinpsoriaticarthritis