Cargando…

Behavioural economics in fisheries: A systematic review protocol

BACKGROUND: The field of behavioural economics holds several opportunities for integrated fisheries management and conservation and can help researchers and managers alike understand fisher behaviour and decision-making. As the study of the cognitive biases that influence decision-making processes,...

Descripción completa

Detalles Bibliográficos
Autores principales: Wieczorek, Alina M., Schadeberg, Amanda, Krogh Hallin, Julie, van Putten, Ingrid, Kraak, Sarah B. M., Richter, Andries, Clay, Patricia M., Goti Aralucea, Leyre, Pedreschi, Debbi, Hamon, Katell G., Dankel, Dorothy J., Mackay, Mary
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Public Library of Science 2021
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8389455/
https://www.ncbi.nlm.nih.gov/pubmed/34437562
http://dx.doi.org/10.1371/journal.pone.0255333
_version_ 1783742864400842752
author Wieczorek, Alina M.
Schadeberg, Amanda
Krogh Hallin, Julie
van Putten, Ingrid
Kraak, Sarah B. M.
Richter, Andries
Clay, Patricia M.
Goti Aralucea, Leyre
Pedreschi, Debbi
Hamon, Katell G.
Dankel, Dorothy J.
Mackay, Mary
author_facet Wieczorek, Alina M.
Schadeberg, Amanda
Krogh Hallin, Julie
van Putten, Ingrid
Kraak, Sarah B. M.
Richter, Andries
Clay, Patricia M.
Goti Aralucea, Leyre
Pedreschi, Debbi
Hamon, Katell G.
Dankel, Dorothy J.
Mackay, Mary
author_sort Wieczorek, Alina M.
collection PubMed
description BACKGROUND: The field of behavioural economics holds several opportunities for integrated fisheries management and conservation and can help researchers and managers alike understand fisher behaviour and decision-making. As the study of the cognitive biases that influence decision-making processes, behavioural economics differentiates itself from the classical field of economics in that it does not assume strictly rational behaviour of its agents, but rather looks for all mechanisms that influence behaviour. This field offers potential applications for fisheries management, for example in relation to behavioural change, but such applications require evidence of these mechanisms applied in a fisheries context. Thus, we have developed a systematic literature review protocol focusing on the primary question: “Which behavioural economics mechanisms influence fisher behaviour?” The aim is to provide a comprehensive overview of these different mechanisms and how they have been applied in the study of fisher behaviour. METHODS AND EXPECTED OUTPUTS: The review protocol was developed in close collaboration with the International Council for the Exploration of the Sea (ICES) Working Group on Maritime Systems (WGMARS). WGMARS members were therefore considered the key stakeholders for this study, and were consulted to develop a suitable systematic review question and methodology. Three academic databases will be searched using a customized Boolean keyword search string. Research articles deemed eligible for inclusion in the systematic review are those that studied the influence of behavioural-economics mechanisms on the behaviour of marine fishers in any location, and at any scale. Insights from this literature will be collated in order to provide an overview of the relevant behavioural-economics mechanisms and actions, how effective these mechanisms are and at what scale, geographic region and in which fisheries sector they have been applied. Any fisheries management implications identified by the studies under review will also be outlined. Finally, it will be recorded whether or not ethical considerations were made in the reviewed literature, so that in the discussion it will be possible to reflect on the ethics of conducting behavioural-economics research and policy actions in a fisheries context.
format Online
Article
Text
id pubmed-8389455
institution National Center for Biotechnology Information
language English
publishDate 2021
publisher Public Library of Science
record_format MEDLINE/PubMed
spelling pubmed-83894552021-08-27 Behavioural economics in fisheries: A systematic review protocol Wieczorek, Alina M. Schadeberg, Amanda Krogh Hallin, Julie van Putten, Ingrid Kraak, Sarah B. M. Richter, Andries Clay, Patricia M. Goti Aralucea, Leyre Pedreschi, Debbi Hamon, Katell G. Dankel, Dorothy J. Mackay, Mary PLoS One Registered Report Protocol BACKGROUND: The field of behavioural economics holds several opportunities for integrated fisheries management and conservation and can help researchers and managers alike understand fisher behaviour and decision-making. As the study of the cognitive biases that influence decision-making processes, behavioural economics differentiates itself from the classical field of economics in that it does not assume strictly rational behaviour of its agents, but rather looks for all mechanisms that influence behaviour. This field offers potential applications for fisheries management, for example in relation to behavioural change, but such applications require evidence of these mechanisms applied in a fisheries context. Thus, we have developed a systematic literature review protocol focusing on the primary question: “Which behavioural economics mechanisms influence fisher behaviour?” The aim is to provide a comprehensive overview of these different mechanisms and how they have been applied in the study of fisher behaviour. METHODS AND EXPECTED OUTPUTS: The review protocol was developed in close collaboration with the International Council for the Exploration of the Sea (ICES) Working Group on Maritime Systems (WGMARS). WGMARS members were therefore considered the key stakeholders for this study, and were consulted to develop a suitable systematic review question and methodology. Three academic databases will be searched using a customized Boolean keyword search string. Research articles deemed eligible for inclusion in the systematic review are those that studied the influence of behavioural-economics mechanisms on the behaviour of marine fishers in any location, and at any scale. Insights from this literature will be collated in order to provide an overview of the relevant behavioural-economics mechanisms and actions, how effective these mechanisms are and at what scale, geographic region and in which fisheries sector they have been applied. Any fisheries management implications identified by the studies under review will also be outlined. Finally, it will be recorded whether or not ethical considerations were made in the reviewed literature, so that in the discussion it will be possible to reflect on the ethics of conducting behavioural-economics research and policy actions in a fisheries context. Public Library of Science 2021-08-26 /pmc/articles/PMC8389455/ /pubmed/34437562 http://dx.doi.org/10.1371/journal.pone.0255333 Text en https://creativecommons.org/publicdomain/zero/1.0/This is an open access article, free of all copyright, and may be freely reproduced, distributed, transmitted, modified, built upon, or otherwise used by anyone for any lawful purpose. The work is made available under the Creative Commons CC0 (https://creativecommons.org/publicdomain/zero/1.0/) public domain dedication.
spellingShingle Registered Report Protocol
Wieczorek, Alina M.
Schadeberg, Amanda
Krogh Hallin, Julie
van Putten, Ingrid
Kraak, Sarah B. M.
Richter, Andries
Clay, Patricia M.
Goti Aralucea, Leyre
Pedreschi, Debbi
Hamon, Katell G.
Dankel, Dorothy J.
Mackay, Mary
Behavioural economics in fisheries: A systematic review protocol
title Behavioural economics in fisheries: A systematic review protocol
title_full Behavioural economics in fisheries: A systematic review protocol
title_fullStr Behavioural economics in fisheries: A systematic review protocol
title_full_unstemmed Behavioural economics in fisheries: A systematic review protocol
title_short Behavioural economics in fisheries: A systematic review protocol
title_sort behavioural economics in fisheries: a systematic review protocol
topic Registered Report Protocol
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8389455/
https://www.ncbi.nlm.nih.gov/pubmed/34437562
http://dx.doi.org/10.1371/journal.pone.0255333
work_keys_str_mv AT wieczorekalinam behaviouraleconomicsinfisheriesasystematicreviewprotocol
AT schadebergamanda behaviouraleconomicsinfisheriesasystematicreviewprotocol
AT kroghhallinjulie behaviouraleconomicsinfisheriesasystematicreviewprotocol
AT vanputteningrid behaviouraleconomicsinfisheriesasystematicreviewprotocol
AT kraaksarahbm behaviouraleconomicsinfisheriesasystematicreviewprotocol
AT richterandries behaviouraleconomicsinfisheriesasystematicreviewprotocol
AT claypatriciam behaviouraleconomicsinfisheriesasystematicreviewprotocol
AT gotiaralucealeyre behaviouraleconomicsinfisheriesasystematicreviewprotocol
AT pedreschidebbi behaviouraleconomicsinfisheriesasystematicreviewprotocol
AT hamonkatellg behaviouraleconomicsinfisheriesasystematicreviewprotocol
AT dankeldorothyj behaviouraleconomicsinfisheriesasystematicreviewprotocol
AT mackaymary behaviouraleconomicsinfisheriesasystematicreviewprotocol