Cargando…

Hydrolysed Formulas in the Management of Cow’s Milk Allergy: New Insights, Pitfalls and Tips

An allergy to cow’s milk requires the avoidance of cow’s milk proteins and, in some infants, the use of a hypoallergenic formula. This review aims to summarize the current evidence concerning different types of hydrolysed formulas (HF), and recommendations for the treatment of IgE- and non-IgE-media...

Descripción completa

Detalles Bibliográficos
Autores principales: D’Auria, Enza, Salvatore, Silvia, Acunzo, Miriam, Peroni, Diego, Pendezza, Erica, Di Profio, Elisabetta, Fiore, Giulia, Zuccotti, Gian Vincenzo, Verduci, Elvira
Formato: Online Artículo Texto
Lenguaje:English
Publicado: MDPI 2021
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8401609/
https://www.ncbi.nlm.nih.gov/pubmed/34444922
http://dx.doi.org/10.3390/nu13082762
_version_ 1783745591237410816
author D’Auria, Enza
Salvatore, Silvia
Acunzo, Miriam
Peroni, Diego
Pendezza, Erica
Di Profio, Elisabetta
Fiore, Giulia
Zuccotti, Gian Vincenzo
Verduci, Elvira
author_facet D’Auria, Enza
Salvatore, Silvia
Acunzo, Miriam
Peroni, Diego
Pendezza, Erica
Di Profio, Elisabetta
Fiore, Giulia
Zuccotti, Gian Vincenzo
Verduci, Elvira
author_sort D’Auria, Enza
collection PubMed
description An allergy to cow’s milk requires the avoidance of cow’s milk proteins and, in some infants, the use of a hypoallergenic formula. This review aims to summarize the current evidence concerning different types of hydrolysed formulas (HF), and recommendations for the treatment of IgE- and non-IgE-mediated cow’s milk allergy and functional gastrointestinal disorders in infancy, for which some dietary intervention and HF may be of benefit to both immune and motor mechanisms. Current guidelines recommend cow’s milk protein (i.e., whey or casein) extensively hydrolysed formula (eHF) as the first choice for cow’s milk allergy treatment, and amino acid formulas for more severe cases or those with reactions to eHF. Rice hydrolysed formulas (rHF) have also become available in recent years. Both eHF and rHF are well tolerated by the majority of children allergic to cow’s milk, with no concerns regarding body growth or adverse effects. Some hydrolysates may have a pro-active effect in modulating the immune system due to the presence of small peptides and additional components, like biotics. Despite encouraging results on tolerance acquisition, evidence is still not conclusive, thus hampering our ability to draw firm conclusions. In clinical practice, the choice of hypoallergenic formula should be based on the infant’s age, the severity, frequency and persistence of symptoms, immune phenotype, growth pattern, formula cost, and in vivo proof of tolerance and efficacy.
format Online
Article
Text
id pubmed-8401609
institution National Center for Biotechnology Information
language English
publishDate 2021
publisher MDPI
record_format MEDLINE/PubMed
spelling pubmed-84016092021-08-29 Hydrolysed Formulas in the Management of Cow’s Milk Allergy: New Insights, Pitfalls and Tips D’Auria, Enza Salvatore, Silvia Acunzo, Miriam Peroni, Diego Pendezza, Erica Di Profio, Elisabetta Fiore, Giulia Zuccotti, Gian Vincenzo Verduci, Elvira Nutrients Review An allergy to cow’s milk requires the avoidance of cow’s milk proteins and, in some infants, the use of a hypoallergenic formula. This review aims to summarize the current evidence concerning different types of hydrolysed formulas (HF), and recommendations for the treatment of IgE- and non-IgE-mediated cow’s milk allergy and functional gastrointestinal disorders in infancy, for which some dietary intervention and HF may be of benefit to both immune and motor mechanisms. Current guidelines recommend cow’s milk protein (i.e., whey or casein) extensively hydrolysed formula (eHF) as the first choice for cow’s milk allergy treatment, and amino acid formulas for more severe cases or those with reactions to eHF. Rice hydrolysed formulas (rHF) have also become available in recent years. Both eHF and rHF are well tolerated by the majority of children allergic to cow’s milk, with no concerns regarding body growth or adverse effects. Some hydrolysates may have a pro-active effect in modulating the immune system due to the presence of small peptides and additional components, like biotics. Despite encouraging results on tolerance acquisition, evidence is still not conclusive, thus hampering our ability to draw firm conclusions. In clinical practice, the choice of hypoallergenic formula should be based on the infant’s age, the severity, frequency and persistence of symptoms, immune phenotype, growth pattern, formula cost, and in vivo proof of tolerance and efficacy. MDPI 2021-08-12 /pmc/articles/PMC8401609/ /pubmed/34444922 http://dx.doi.org/10.3390/nu13082762 Text en © 2021 by the authors. https://creativecommons.org/licenses/by/4.0/Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/).
spellingShingle Review
D’Auria, Enza
Salvatore, Silvia
Acunzo, Miriam
Peroni, Diego
Pendezza, Erica
Di Profio, Elisabetta
Fiore, Giulia
Zuccotti, Gian Vincenzo
Verduci, Elvira
Hydrolysed Formulas in the Management of Cow’s Milk Allergy: New Insights, Pitfalls and Tips
title Hydrolysed Formulas in the Management of Cow’s Milk Allergy: New Insights, Pitfalls and Tips
title_full Hydrolysed Formulas in the Management of Cow’s Milk Allergy: New Insights, Pitfalls and Tips
title_fullStr Hydrolysed Formulas in the Management of Cow’s Milk Allergy: New Insights, Pitfalls and Tips
title_full_unstemmed Hydrolysed Formulas in the Management of Cow’s Milk Allergy: New Insights, Pitfalls and Tips
title_short Hydrolysed Formulas in the Management of Cow’s Milk Allergy: New Insights, Pitfalls and Tips
title_sort hydrolysed formulas in the management of cow’s milk allergy: new insights, pitfalls and tips
topic Review
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8401609/
https://www.ncbi.nlm.nih.gov/pubmed/34444922
http://dx.doi.org/10.3390/nu13082762
work_keys_str_mv AT dauriaenza hydrolysedformulasinthemanagementofcowsmilkallergynewinsightspitfallsandtips
AT salvatoresilvia hydrolysedformulasinthemanagementofcowsmilkallergynewinsightspitfallsandtips
AT acunzomiriam hydrolysedformulasinthemanagementofcowsmilkallergynewinsightspitfallsandtips
AT peronidiego hydrolysedformulasinthemanagementofcowsmilkallergynewinsightspitfallsandtips
AT pendezzaerica hydrolysedformulasinthemanagementofcowsmilkallergynewinsightspitfallsandtips
AT diprofioelisabetta hydrolysedformulasinthemanagementofcowsmilkallergynewinsightspitfallsandtips
AT fioregiulia hydrolysedformulasinthemanagementofcowsmilkallergynewinsightspitfallsandtips
AT zuccottigianvincenzo hydrolysedformulasinthemanagementofcowsmilkallergynewinsightspitfallsandtips
AT verducielvira hydrolysedformulasinthemanagementofcowsmilkallergynewinsightspitfallsandtips