Cargando…
Perioperative risk factors for new-onset postoperative atrial fibrillation after coronary artery bypass grafting: a systematic review
BACKGROUND: Postoperative atrial fibrillation (POAF) is the most common cardiac dysrhythmia to occur after coronary artery bypass grafting (CABG). However, the risk factors for new-onset POAF after CABG during the perioperative period have yet to be clearly defined. Accordingly, the aim of our syste...
Autores principales: | , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2021
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8414730/ https://www.ncbi.nlm.nih.gov/pubmed/34479482 http://dx.doi.org/10.1186/s12872-021-02224-x |
_version_ | 1783747838251892736 |
---|---|
author | Seo, Eun Ji Hong, Joonhwa Lee, Hyeon-Ju Son, Youn-Jung |
author_facet | Seo, Eun Ji Hong, Joonhwa Lee, Hyeon-Ju Son, Youn-Jung |
author_sort | Seo, Eun Ji |
collection | PubMed |
description | BACKGROUND: Postoperative atrial fibrillation (POAF) is the most common cardiac dysrhythmia to occur after coronary artery bypass grafting (CABG). However, the risk factors for new-onset POAF after CABG during the perioperative period have yet to be clearly defined. Accordingly, the aim of our systematic review was to evaluate the perioperative predictors of new-onset POAF after isolated CABG. METHOD: Our review methods adhered to the Preferred Reporting Items for Systematic Reviews and Meta-Analyses guideline. We searched seven electronic databases (PubMed, Embase, CINAHL, PsycArticles, Cochrane, Web of Science, and SCOPUS) to identify all relevant English articles published up to January 2020. Identified studies were screened independently by two researchers for selection, according to predefined criteria. The Newcastle–Ottawa Scale was used to evaluate the quality of studies retained. RESULTS: After screening, nine studies were retained for analysis, including 4798 patients, of whom 1555 (32.4%) experienced new-onset POAF after CABG. The incidence rate of new-onset POAF ranged between 17.3% and 47.4%. The following risk factors were identified: old age (p < 0.001), a high preoperative serum creatinine level (p = 0.001), a low preoperative hemoglobin level (p = 0.007), a low left ventricle ejection fraction in Asian patients (p = 0.001), essential hypertension (p < 0.001), chronic obstructive pulmonary disease (p = 0.010), renal failure (p = 0.009), cardiopulmonary bypass use (p = 0.002), perfusion time (p = 0.017), postoperative use of inotropes (p < 0.001), postoperative renal failure (p = 0.001), and re-operation (p = 0.005). All studies included in the analysis were of good quality. CONCLUSIONS: The risk factors identified in our review could be used to improve monitoring of at-risk patients for early detection and treatment of new-onset POAF after CABG, reducing the risk of other complications and negative clinical outcomes. SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1186/s12872-021-02224-x. |
format | Online Article Text |
id | pubmed-8414730 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2021 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-84147302021-09-09 Perioperative risk factors for new-onset postoperative atrial fibrillation after coronary artery bypass grafting: a systematic review Seo, Eun Ji Hong, Joonhwa Lee, Hyeon-Ju Son, Youn-Jung BMC Cardiovasc Disord Research Article BACKGROUND: Postoperative atrial fibrillation (POAF) is the most common cardiac dysrhythmia to occur after coronary artery bypass grafting (CABG). However, the risk factors for new-onset POAF after CABG during the perioperative period have yet to be clearly defined. Accordingly, the aim of our systematic review was to evaluate the perioperative predictors of new-onset POAF after isolated CABG. METHOD: Our review methods adhered to the Preferred Reporting Items for Systematic Reviews and Meta-Analyses guideline. We searched seven electronic databases (PubMed, Embase, CINAHL, PsycArticles, Cochrane, Web of Science, and SCOPUS) to identify all relevant English articles published up to January 2020. Identified studies were screened independently by two researchers for selection, according to predefined criteria. The Newcastle–Ottawa Scale was used to evaluate the quality of studies retained. RESULTS: After screening, nine studies were retained for analysis, including 4798 patients, of whom 1555 (32.4%) experienced new-onset POAF after CABG. The incidence rate of new-onset POAF ranged between 17.3% and 47.4%. The following risk factors were identified: old age (p < 0.001), a high preoperative serum creatinine level (p = 0.001), a low preoperative hemoglobin level (p = 0.007), a low left ventricle ejection fraction in Asian patients (p = 0.001), essential hypertension (p < 0.001), chronic obstructive pulmonary disease (p = 0.010), renal failure (p = 0.009), cardiopulmonary bypass use (p = 0.002), perfusion time (p = 0.017), postoperative use of inotropes (p < 0.001), postoperative renal failure (p = 0.001), and re-operation (p = 0.005). All studies included in the analysis were of good quality. CONCLUSIONS: The risk factors identified in our review could be used to improve monitoring of at-risk patients for early detection and treatment of new-onset POAF after CABG, reducing the risk of other complications and negative clinical outcomes. SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1186/s12872-021-02224-x. BioMed Central 2021-09-03 /pmc/articles/PMC8414730/ /pubmed/34479482 http://dx.doi.org/10.1186/s12872-021-02224-x Text en © The Author(s) 2021 https://creativecommons.org/licenses/by/4.0/Open AccessThis article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/ (https://creativecommons.org/licenses/by/4.0/) . The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/ (https://creativecommons.org/publicdomain/zero/1.0/) ) applies to the data made available in this article, unless otherwise stated in a credit line to the data. |
spellingShingle | Research Article Seo, Eun Ji Hong, Joonhwa Lee, Hyeon-Ju Son, Youn-Jung Perioperative risk factors for new-onset postoperative atrial fibrillation after coronary artery bypass grafting: a systematic review |
title | Perioperative risk factors for new-onset postoperative atrial fibrillation after coronary artery bypass grafting: a systematic review |
title_full | Perioperative risk factors for new-onset postoperative atrial fibrillation after coronary artery bypass grafting: a systematic review |
title_fullStr | Perioperative risk factors for new-onset postoperative atrial fibrillation after coronary artery bypass grafting: a systematic review |
title_full_unstemmed | Perioperative risk factors for new-onset postoperative atrial fibrillation after coronary artery bypass grafting: a systematic review |
title_short | Perioperative risk factors for new-onset postoperative atrial fibrillation after coronary artery bypass grafting: a systematic review |
title_sort | perioperative risk factors for new-onset postoperative atrial fibrillation after coronary artery bypass grafting: a systematic review |
topic | Research Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8414730/ https://www.ncbi.nlm.nih.gov/pubmed/34479482 http://dx.doi.org/10.1186/s12872-021-02224-x |
work_keys_str_mv | AT seoeunji perioperativeriskfactorsfornewonsetpostoperativeatrialfibrillationaftercoronaryarterybypassgraftingasystematicreview AT hongjoonhwa perioperativeriskfactorsfornewonsetpostoperativeatrialfibrillationaftercoronaryarterybypassgraftingasystematicreview AT leehyeonju perioperativeriskfactorsfornewonsetpostoperativeatrialfibrillationaftercoronaryarterybypassgraftingasystematicreview AT sonyounjung perioperativeriskfactorsfornewonsetpostoperativeatrialfibrillationaftercoronaryarterybypassgraftingasystematicreview |