Cargando…

Exploration of antigenic determinants in spike glycoprotein of SARS-CoV2 and identification of five salient potential epitopes

Emerging pathogens have been an eternal threat to mankind. In a series of pandemics caused by notorious coronaviruses, a newly emerged SARS-CoV2 virus is creating panic among the world population. The unavailability of reliable theranostics insists the exploration of antigenic determinants in spike...

Descripción completa

Detalles Bibliográficos
Autores principales: Agrawal, Aditya, Varshney, Rajat, Pathak, Mamta, Patel, Shailesh Kumar, Rai, Vishal, Sulabh, Sourabh, Gupta, Rohini, Solanki, Khushal Singh, Varshney, Ritu, Nimmanapalli, Ramadevi
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Springer India 2021
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8422955/
https://www.ncbi.nlm.nih.gov/pubmed/34514073
http://dx.doi.org/10.1007/s13337-021-00737-9
_version_ 1783749376888274944
author Agrawal, Aditya
Varshney, Rajat
Pathak, Mamta
Patel, Shailesh Kumar
Rai, Vishal
Sulabh, Sourabh
Gupta, Rohini
Solanki, Khushal Singh
Varshney, Ritu
Nimmanapalli, Ramadevi
author_facet Agrawal, Aditya
Varshney, Rajat
Pathak, Mamta
Patel, Shailesh Kumar
Rai, Vishal
Sulabh, Sourabh
Gupta, Rohini
Solanki, Khushal Singh
Varshney, Ritu
Nimmanapalli, Ramadevi
author_sort Agrawal, Aditya
collection PubMed
description Emerging pathogens have been an eternal threat to mankind. In a series of pandemics caused by notorious coronaviruses, a newly emerged SARS-CoV2 virus is creating panic among the world population. The unavailability of reliable theranostics insists the exploration of antigenic determinants in spike glycoprotein of SARS-CoV2. The four novel inserts (‘(70)VSGTNGT(76)’, ‘(150)KSWM(153)’, (247)SYLTPG(252) and (674)QTQTNSPRR(682)) in SARS-CoV2 spike protein were unraveled via multiple sequence alignment of spike proteins of SARS-CoV2, SARS-CoV, and MERS-CoV. The three-dimension (3D) modeling of the spike protein of the SARS-CoV2 and their interaction with the ACE2 receptor was delineated with the help of SWISS-MODEL and 3DLigandSite web servers. The predicted 3D model of SARS-CoV2 was further verified by SAVES, RAMPAGE, and ProSA-web tools. The potential B-cell immunogenic epitopes of SARS-CoV2 were predicted out by using various software viz. IEDB B-cell epitopes prediction tool, BepiPred linear epitope prediction tool, Emini Surface Accessibility Prediction tool, and Kolaskar-Tongaonkar antigenicity web tool. The five epitopes (i.e. ‘(71)SGTNGTKRFDN(81), (247)SYLTPG(252), (634)RVYST(638), (675)QTQTNSPRRARSV(687), and (1054)QSAPH(1058)) were selected as potent antigenic determinants. The quantum of information generated by this study will prove beneficial for the development of effective therapeutics, diagnostics, and multi-epitopic vaccines to combat this ongoing menace.
format Online
Article
Text
id pubmed-8422955
institution National Center for Biotechnology Information
language English
publishDate 2021
publisher Springer India
record_format MEDLINE/PubMed
spelling pubmed-84229552021-09-08 Exploration of antigenic determinants in spike glycoprotein of SARS-CoV2 and identification of five salient potential epitopes Agrawal, Aditya Varshney, Rajat Pathak, Mamta Patel, Shailesh Kumar Rai, Vishal Sulabh, Sourabh Gupta, Rohini Solanki, Khushal Singh Varshney, Ritu Nimmanapalli, Ramadevi Virusdisease Short Communication Emerging pathogens have been an eternal threat to mankind. In a series of pandemics caused by notorious coronaviruses, a newly emerged SARS-CoV2 virus is creating panic among the world population. The unavailability of reliable theranostics insists the exploration of antigenic determinants in spike glycoprotein of SARS-CoV2. The four novel inserts (‘(70)VSGTNGT(76)’, ‘(150)KSWM(153)’, (247)SYLTPG(252) and (674)QTQTNSPRR(682)) in SARS-CoV2 spike protein were unraveled via multiple sequence alignment of spike proteins of SARS-CoV2, SARS-CoV, and MERS-CoV. The three-dimension (3D) modeling of the spike protein of the SARS-CoV2 and their interaction with the ACE2 receptor was delineated with the help of SWISS-MODEL and 3DLigandSite web servers. The predicted 3D model of SARS-CoV2 was further verified by SAVES, RAMPAGE, and ProSA-web tools. The potential B-cell immunogenic epitopes of SARS-CoV2 were predicted out by using various software viz. IEDB B-cell epitopes prediction tool, BepiPred linear epitope prediction tool, Emini Surface Accessibility Prediction tool, and Kolaskar-Tongaonkar antigenicity web tool. The five epitopes (i.e. ‘(71)SGTNGTKRFDN(81), (247)SYLTPG(252), (634)RVYST(638), (675)QTQTNSPRRARSV(687), and (1054)QSAPH(1058)) were selected as potent antigenic determinants. The quantum of information generated by this study will prove beneficial for the development of effective therapeutics, diagnostics, and multi-epitopic vaccines to combat this ongoing menace. Springer India 2021-09-07 2021-12 /pmc/articles/PMC8422955/ /pubmed/34514073 http://dx.doi.org/10.1007/s13337-021-00737-9 Text en © Indian Virological Society 2021
spellingShingle Short Communication
Agrawal, Aditya
Varshney, Rajat
Pathak, Mamta
Patel, Shailesh Kumar
Rai, Vishal
Sulabh, Sourabh
Gupta, Rohini
Solanki, Khushal Singh
Varshney, Ritu
Nimmanapalli, Ramadevi
Exploration of antigenic determinants in spike glycoprotein of SARS-CoV2 and identification of five salient potential epitopes
title Exploration of antigenic determinants in spike glycoprotein of SARS-CoV2 and identification of five salient potential epitopes
title_full Exploration of antigenic determinants in spike glycoprotein of SARS-CoV2 and identification of five salient potential epitopes
title_fullStr Exploration of antigenic determinants in spike glycoprotein of SARS-CoV2 and identification of five salient potential epitopes
title_full_unstemmed Exploration of antigenic determinants in spike glycoprotein of SARS-CoV2 and identification of five salient potential epitopes
title_short Exploration of antigenic determinants in spike glycoprotein of SARS-CoV2 and identification of five salient potential epitopes
title_sort exploration of antigenic determinants in spike glycoprotein of sars-cov2 and identification of five salient potential epitopes
topic Short Communication
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8422955/
https://www.ncbi.nlm.nih.gov/pubmed/34514073
http://dx.doi.org/10.1007/s13337-021-00737-9
work_keys_str_mv AT agrawaladitya explorationofantigenicdeterminantsinspikeglycoproteinofsarscov2andidentificationoffivesalientpotentialepitopes
AT varshneyrajat explorationofantigenicdeterminantsinspikeglycoproteinofsarscov2andidentificationoffivesalientpotentialepitopes
AT pathakmamta explorationofantigenicdeterminantsinspikeglycoproteinofsarscov2andidentificationoffivesalientpotentialepitopes
AT patelshaileshkumar explorationofantigenicdeterminantsinspikeglycoproteinofsarscov2andidentificationoffivesalientpotentialepitopes
AT raivishal explorationofantigenicdeterminantsinspikeglycoproteinofsarscov2andidentificationoffivesalientpotentialepitopes
AT sulabhsourabh explorationofantigenicdeterminantsinspikeglycoproteinofsarscov2andidentificationoffivesalientpotentialepitopes
AT guptarohini explorationofantigenicdeterminantsinspikeglycoproteinofsarscov2andidentificationoffivesalientpotentialepitopes
AT solankikhushalsingh explorationofantigenicdeterminantsinspikeglycoproteinofsarscov2andidentificationoffivesalientpotentialepitopes
AT varshneyritu explorationofantigenicdeterminantsinspikeglycoproteinofsarscov2andidentificationoffivesalientpotentialepitopes
AT nimmanapalliramadevi explorationofantigenicdeterminantsinspikeglycoproteinofsarscov2andidentificationoffivesalientpotentialepitopes