Cargando…
Intrinsically disordered protein biosensor tracks the physical-chemical effects of osmotic stress on cells
Cell homeostasis is perturbed when dramatic shifts in the external environment cause the physical-chemical properties inside the cell to change. Experimental approaches for dynamically monitoring these intracellular effects are currently lacking. Here, we leverage the environmental sensitivity and s...
Autores principales: | , , , , , , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Nature Publishing Group UK
2021
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8440526/ https://www.ncbi.nlm.nih.gov/pubmed/34521831 http://dx.doi.org/10.1038/s41467-021-25736-8 |
_version_ | 1783752694475784192 |
---|---|
author | Cuevas-Velazquez, Cesar L. Vellosillo, Tamara Guadalupe, Karina Schmidt, Hermann Broder Yu, Feng Moses, David Brophy, Jennifer A. N. Cosio-Acosta, Dante Das, Alakananda Wang, Lingxin Jones, Alexander M. Covarrubias, Alejandra A. Sukenik, Shahar Dinneny, José R. |
author_facet | Cuevas-Velazquez, Cesar L. Vellosillo, Tamara Guadalupe, Karina Schmidt, Hermann Broder Yu, Feng Moses, David Brophy, Jennifer A. N. Cosio-Acosta, Dante Das, Alakananda Wang, Lingxin Jones, Alexander M. Covarrubias, Alejandra A. Sukenik, Shahar Dinneny, José R. |
author_sort | Cuevas-Velazquez, Cesar L. |
collection | PubMed |
description | Cell homeostasis is perturbed when dramatic shifts in the external environment cause the physical-chemical properties inside the cell to change. Experimental approaches for dynamically monitoring these intracellular effects are currently lacking. Here, we leverage the environmental sensitivity and structural plasticity of intrinsically disordered protein regions (IDRs) to develop a FRET biosensor capable of monitoring rapid intracellular changes caused by osmotic stress. The biosensor, named SED1, utilizes the Arabidopsis intrinsically disordered AtLEA4-5 protein expressed in plants under water deficit. Computational modeling and in vitro studies reveal that SED1 is highly sensitive to macromolecular crowding. SED1 exhibits large and near-linear osmolarity-dependent changes in FRET inside living bacteria, yeast, plant, and human cells, demonstrating the broad utility of this tool for studying water-associated stress. This study demonstrates the remarkable ability of IDRs to sense the cellular environment across the tree of life and provides a blueprint for their use as environmentally-responsive molecular tools. |
format | Online Article Text |
id | pubmed-8440526 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2021 |
publisher | Nature Publishing Group UK |
record_format | MEDLINE/PubMed |
spelling | pubmed-84405262021-10-04 Intrinsically disordered protein biosensor tracks the physical-chemical effects of osmotic stress on cells Cuevas-Velazquez, Cesar L. Vellosillo, Tamara Guadalupe, Karina Schmidt, Hermann Broder Yu, Feng Moses, David Brophy, Jennifer A. N. Cosio-Acosta, Dante Das, Alakananda Wang, Lingxin Jones, Alexander M. Covarrubias, Alejandra A. Sukenik, Shahar Dinneny, José R. Nat Commun Article Cell homeostasis is perturbed when dramatic shifts in the external environment cause the physical-chemical properties inside the cell to change. Experimental approaches for dynamically monitoring these intracellular effects are currently lacking. Here, we leverage the environmental sensitivity and structural plasticity of intrinsically disordered protein regions (IDRs) to develop a FRET biosensor capable of monitoring rapid intracellular changes caused by osmotic stress. The biosensor, named SED1, utilizes the Arabidopsis intrinsically disordered AtLEA4-5 protein expressed in plants under water deficit. Computational modeling and in vitro studies reveal that SED1 is highly sensitive to macromolecular crowding. SED1 exhibits large and near-linear osmolarity-dependent changes in FRET inside living bacteria, yeast, plant, and human cells, demonstrating the broad utility of this tool for studying water-associated stress. This study demonstrates the remarkable ability of IDRs to sense the cellular environment across the tree of life and provides a blueprint for their use as environmentally-responsive molecular tools. Nature Publishing Group UK 2021-09-14 /pmc/articles/PMC8440526/ /pubmed/34521831 http://dx.doi.org/10.1038/s41467-021-25736-8 Text en © The Author(s) 2021 https://creativecommons.org/licenses/by/4.0/Open Access This article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The images or other third party material in this article are included in the article’s Creative Commons license, unless indicated otherwise in a credit line to the material. If material is not included in the article’s Creative Commons license and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this license, visit http://creativecommons.org/licenses/by/4.0/ (https://creativecommons.org/licenses/by/4.0/) . |
spellingShingle | Article Cuevas-Velazquez, Cesar L. Vellosillo, Tamara Guadalupe, Karina Schmidt, Hermann Broder Yu, Feng Moses, David Brophy, Jennifer A. N. Cosio-Acosta, Dante Das, Alakananda Wang, Lingxin Jones, Alexander M. Covarrubias, Alejandra A. Sukenik, Shahar Dinneny, José R. Intrinsically disordered protein biosensor tracks the physical-chemical effects of osmotic stress on cells |
title | Intrinsically disordered protein biosensor tracks the physical-chemical effects of osmotic stress on cells |
title_full | Intrinsically disordered protein biosensor tracks the physical-chemical effects of osmotic stress on cells |
title_fullStr | Intrinsically disordered protein biosensor tracks the physical-chemical effects of osmotic stress on cells |
title_full_unstemmed | Intrinsically disordered protein biosensor tracks the physical-chemical effects of osmotic stress on cells |
title_short | Intrinsically disordered protein biosensor tracks the physical-chemical effects of osmotic stress on cells |
title_sort | intrinsically disordered protein biosensor tracks the physical-chemical effects of osmotic stress on cells |
topic | Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8440526/ https://www.ncbi.nlm.nih.gov/pubmed/34521831 http://dx.doi.org/10.1038/s41467-021-25736-8 |
work_keys_str_mv | AT cuevasvelazquezcesarl intrinsicallydisorderedproteinbiosensortracksthephysicalchemicaleffectsofosmoticstressoncells AT vellosillotamara intrinsicallydisorderedproteinbiosensortracksthephysicalchemicaleffectsofosmoticstressoncells AT guadalupekarina intrinsicallydisorderedproteinbiosensortracksthephysicalchemicaleffectsofosmoticstressoncells AT schmidthermannbroder intrinsicallydisorderedproteinbiosensortracksthephysicalchemicaleffectsofosmoticstressoncells AT yufeng intrinsicallydisorderedproteinbiosensortracksthephysicalchemicaleffectsofosmoticstressoncells AT mosesdavid intrinsicallydisorderedproteinbiosensortracksthephysicalchemicaleffectsofosmoticstressoncells AT brophyjenniferan intrinsicallydisorderedproteinbiosensortracksthephysicalchemicaleffectsofosmoticstressoncells AT cosioacostadante intrinsicallydisorderedproteinbiosensortracksthephysicalchemicaleffectsofosmoticstressoncells AT dasalakananda intrinsicallydisorderedproteinbiosensortracksthephysicalchemicaleffectsofosmoticstressoncells AT wanglingxin intrinsicallydisorderedproteinbiosensortracksthephysicalchemicaleffectsofosmoticstressoncells AT jonesalexanderm intrinsicallydisorderedproteinbiosensortracksthephysicalchemicaleffectsofosmoticstressoncells AT covarrubiasalejandraa intrinsicallydisorderedproteinbiosensortracksthephysicalchemicaleffectsofosmoticstressoncells AT sukenikshahar intrinsicallydisorderedproteinbiosensortracksthephysicalchemicaleffectsofosmoticstressoncells AT dinnenyjoser intrinsicallydisorderedproteinbiosensortracksthephysicalchemicaleffectsofosmoticstressoncells |