Cargando…

Intrinsically disordered protein biosensor tracks the physical-chemical effects of osmotic stress on cells

Cell homeostasis is perturbed when dramatic shifts in the external environment cause the physical-chemical properties inside the cell to change. Experimental approaches for dynamically monitoring these intracellular effects are currently lacking. Here, we leverage the environmental sensitivity and s...

Descripción completa

Detalles Bibliográficos
Autores principales: Cuevas-Velazquez, Cesar L., Vellosillo, Tamara, Guadalupe, Karina, Schmidt, Hermann Broder, Yu, Feng, Moses, David, Brophy, Jennifer A. N., Cosio-Acosta, Dante, Das, Alakananda, Wang, Lingxin, Jones, Alexander M., Covarrubias, Alejandra A., Sukenik, Shahar, Dinneny, José R.
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Nature Publishing Group UK 2021
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8440526/
https://www.ncbi.nlm.nih.gov/pubmed/34521831
http://dx.doi.org/10.1038/s41467-021-25736-8
_version_ 1783752694475784192
author Cuevas-Velazquez, Cesar L.
Vellosillo, Tamara
Guadalupe, Karina
Schmidt, Hermann Broder
Yu, Feng
Moses, David
Brophy, Jennifer A. N.
Cosio-Acosta, Dante
Das, Alakananda
Wang, Lingxin
Jones, Alexander M.
Covarrubias, Alejandra A.
Sukenik, Shahar
Dinneny, José R.
author_facet Cuevas-Velazquez, Cesar L.
Vellosillo, Tamara
Guadalupe, Karina
Schmidt, Hermann Broder
Yu, Feng
Moses, David
Brophy, Jennifer A. N.
Cosio-Acosta, Dante
Das, Alakananda
Wang, Lingxin
Jones, Alexander M.
Covarrubias, Alejandra A.
Sukenik, Shahar
Dinneny, José R.
author_sort Cuevas-Velazquez, Cesar L.
collection PubMed
description Cell homeostasis is perturbed when dramatic shifts in the external environment cause the physical-chemical properties inside the cell to change. Experimental approaches for dynamically monitoring these intracellular effects are currently lacking. Here, we leverage the environmental sensitivity and structural plasticity of intrinsically disordered protein regions (IDRs) to develop a FRET biosensor capable of monitoring rapid intracellular changes caused by osmotic stress. The biosensor, named SED1, utilizes the Arabidopsis intrinsically disordered AtLEA4-5 protein expressed in plants under water deficit. Computational modeling and in vitro studies reveal that SED1 is highly sensitive to macromolecular crowding. SED1 exhibits large and near-linear osmolarity-dependent changes in FRET inside living bacteria, yeast, plant, and human cells, demonstrating the broad utility of this tool for studying water-associated stress. This study demonstrates the remarkable ability of IDRs to sense the cellular environment across the tree of life and provides a blueprint for their use as environmentally-responsive molecular tools.
format Online
Article
Text
id pubmed-8440526
institution National Center for Biotechnology Information
language English
publishDate 2021
publisher Nature Publishing Group UK
record_format MEDLINE/PubMed
spelling pubmed-84405262021-10-04 Intrinsically disordered protein biosensor tracks the physical-chemical effects of osmotic stress on cells Cuevas-Velazquez, Cesar L. Vellosillo, Tamara Guadalupe, Karina Schmidt, Hermann Broder Yu, Feng Moses, David Brophy, Jennifer A. N. Cosio-Acosta, Dante Das, Alakananda Wang, Lingxin Jones, Alexander M. Covarrubias, Alejandra A. Sukenik, Shahar Dinneny, José R. Nat Commun Article Cell homeostasis is perturbed when dramatic shifts in the external environment cause the physical-chemical properties inside the cell to change. Experimental approaches for dynamically monitoring these intracellular effects are currently lacking. Here, we leverage the environmental sensitivity and structural plasticity of intrinsically disordered protein regions (IDRs) to develop a FRET biosensor capable of monitoring rapid intracellular changes caused by osmotic stress. The biosensor, named SED1, utilizes the Arabidopsis intrinsically disordered AtLEA4-5 protein expressed in plants under water deficit. Computational modeling and in vitro studies reveal that SED1 is highly sensitive to macromolecular crowding. SED1 exhibits large and near-linear osmolarity-dependent changes in FRET inside living bacteria, yeast, plant, and human cells, demonstrating the broad utility of this tool for studying water-associated stress. This study demonstrates the remarkable ability of IDRs to sense the cellular environment across the tree of life and provides a blueprint for their use as environmentally-responsive molecular tools. Nature Publishing Group UK 2021-09-14 /pmc/articles/PMC8440526/ /pubmed/34521831 http://dx.doi.org/10.1038/s41467-021-25736-8 Text en © The Author(s) 2021 https://creativecommons.org/licenses/by/4.0/Open Access This article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The images or other third party material in this article are included in the article’s Creative Commons license, unless indicated otherwise in a credit line to the material. If material is not included in the article’s Creative Commons license and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this license, visit http://creativecommons.org/licenses/by/4.0/ (https://creativecommons.org/licenses/by/4.0/) .
spellingShingle Article
Cuevas-Velazquez, Cesar L.
Vellosillo, Tamara
Guadalupe, Karina
Schmidt, Hermann Broder
Yu, Feng
Moses, David
Brophy, Jennifer A. N.
Cosio-Acosta, Dante
Das, Alakananda
Wang, Lingxin
Jones, Alexander M.
Covarrubias, Alejandra A.
Sukenik, Shahar
Dinneny, José R.
Intrinsically disordered protein biosensor tracks the physical-chemical effects of osmotic stress on cells
title Intrinsically disordered protein biosensor tracks the physical-chemical effects of osmotic stress on cells
title_full Intrinsically disordered protein biosensor tracks the physical-chemical effects of osmotic stress on cells
title_fullStr Intrinsically disordered protein biosensor tracks the physical-chemical effects of osmotic stress on cells
title_full_unstemmed Intrinsically disordered protein biosensor tracks the physical-chemical effects of osmotic stress on cells
title_short Intrinsically disordered protein biosensor tracks the physical-chemical effects of osmotic stress on cells
title_sort intrinsically disordered protein biosensor tracks the physical-chemical effects of osmotic stress on cells
topic Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8440526/
https://www.ncbi.nlm.nih.gov/pubmed/34521831
http://dx.doi.org/10.1038/s41467-021-25736-8
work_keys_str_mv AT cuevasvelazquezcesarl intrinsicallydisorderedproteinbiosensortracksthephysicalchemicaleffectsofosmoticstressoncells
AT vellosillotamara intrinsicallydisorderedproteinbiosensortracksthephysicalchemicaleffectsofosmoticstressoncells
AT guadalupekarina intrinsicallydisorderedproteinbiosensortracksthephysicalchemicaleffectsofosmoticstressoncells
AT schmidthermannbroder intrinsicallydisorderedproteinbiosensortracksthephysicalchemicaleffectsofosmoticstressoncells
AT yufeng intrinsicallydisorderedproteinbiosensortracksthephysicalchemicaleffectsofosmoticstressoncells
AT mosesdavid intrinsicallydisorderedproteinbiosensortracksthephysicalchemicaleffectsofosmoticstressoncells
AT brophyjenniferan intrinsicallydisorderedproteinbiosensortracksthephysicalchemicaleffectsofosmoticstressoncells
AT cosioacostadante intrinsicallydisorderedproteinbiosensortracksthephysicalchemicaleffectsofosmoticstressoncells
AT dasalakananda intrinsicallydisorderedproteinbiosensortracksthephysicalchemicaleffectsofosmoticstressoncells
AT wanglingxin intrinsicallydisorderedproteinbiosensortracksthephysicalchemicaleffectsofosmoticstressoncells
AT jonesalexanderm intrinsicallydisorderedproteinbiosensortracksthephysicalchemicaleffectsofosmoticstressoncells
AT covarrubiasalejandraa intrinsicallydisorderedproteinbiosensortracksthephysicalchemicaleffectsofosmoticstressoncells
AT sukenikshahar intrinsicallydisorderedproteinbiosensortracksthephysicalchemicaleffectsofosmoticstressoncells
AT dinnenyjoser intrinsicallydisorderedproteinbiosensortracksthephysicalchemicaleffectsofosmoticstressoncells