Cargando…

Association between emergency medical service transport time and survival in patients with traumatic cardiac arrest: a Nationwide retrospective observational study

BACKGROUND: Patients with traumatic cardiac arrest (TCA) are known to have poor prognoses. In 2003, the joint committee of the National Association of EMS Physicians and the American College of Surgeons Committee on Trauma proposed stopping unsuccessful cardiopulmonary resuscitation (CPR) sustained...

Descripción completa

Detalles Bibliográficos
Autores principales: Naito, Hiromichi, Yumoto, Tetsuya, Yorifuji, Takashi, Nojima, Tsuyoshi, Yamamoto, Hirotsugu, Yamada, Taihei, Tsukahara, Kohei, Inaba, Mototaka, Nishimura, Takeshi, Uehara, Takenori, Nakao, Atsunori
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2021
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8447624/
https://www.ncbi.nlm.nih.gov/pubmed/34530735
http://dx.doi.org/10.1186/s12873-021-00499-z
_version_ 1784569056474431488
author Naito, Hiromichi
Yumoto, Tetsuya
Yorifuji, Takashi
Nojima, Tsuyoshi
Yamamoto, Hirotsugu
Yamada, Taihei
Tsukahara, Kohei
Inaba, Mototaka
Nishimura, Takeshi
Uehara, Takenori
Nakao, Atsunori
author_facet Naito, Hiromichi
Yumoto, Tetsuya
Yorifuji, Takashi
Nojima, Tsuyoshi
Yamamoto, Hirotsugu
Yamada, Taihei
Tsukahara, Kohei
Inaba, Mototaka
Nishimura, Takeshi
Uehara, Takenori
Nakao, Atsunori
author_sort Naito, Hiromichi
collection PubMed
description BACKGROUND: Patients with traumatic cardiac arrest (TCA) are known to have poor prognoses. In 2003, the joint committee of the National Association of EMS Physicians and the American College of Surgeons Committee on Trauma proposed stopping unsuccessful cardiopulmonary resuscitation (CPR) sustained for > 15 min after TCA. However, in 2013, a specific time-limit for terminating resuscitation was dropped, due to the lack of conclusive studies or data. We aimed to define the association between emergency medical services transport time and survival to demonstrate the survival curve of TCA. METHODS: A retrospective review of the Japan Trauma Data Bank. Inclusion criteria were age ≥ 16, at least one trauma with Abbreviated Injury Scale score (AIS) ≥ 3, and CPR performed in a prehospital setting. Exclusion criteria were burn injury, AIS score of 6 in any region, and missing data. Estimated survival rate and risk ratio for survival were analyzed according to transport time for all patients. Analysis was also performed separately on patients with sustained TCA at arrival. RESULTS: Of 292,027 patients in the database, 5336 were included in the study with 4141 sustained TCA. Their median age was 53 years (interquartile range (IQR) 36–70), and 67.2% were male. Their median Injury Severity Score was 29 (IQR 22–41), and median transport time was 11 min (IQR 6–17). Overall survival after TCA was 4.5%; however, survival of patients with sustained TCA at arrival was only 1.2%. The estimated survival rate and risk ratio for sustained TCA rapidly decreased after 15 min of transport time, with estimated survival falling below 1%. CONCLUSION: The chances of survival for sustained TCA declined rapidly while the patient is transported with CPR support. Time should be one reasonable factor for considering termination of resuscitation in patients with sustained TCA, although clinical signs of life, and type and severity of trauma should be taken into account clinically.
format Online
Article
Text
id pubmed-8447624
institution National Center for Biotechnology Information
language English
publishDate 2021
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-84476242021-09-17 Association between emergency medical service transport time and survival in patients with traumatic cardiac arrest: a Nationwide retrospective observational study Naito, Hiromichi Yumoto, Tetsuya Yorifuji, Takashi Nojima, Tsuyoshi Yamamoto, Hirotsugu Yamada, Taihei Tsukahara, Kohei Inaba, Mototaka Nishimura, Takeshi Uehara, Takenori Nakao, Atsunori BMC Emerg Med Research BACKGROUND: Patients with traumatic cardiac arrest (TCA) are known to have poor prognoses. In 2003, the joint committee of the National Association of EMS Physicians and the American College of Surgeons Committee on Trauma proposed stopping unsuccessful cardiopulmonary resuscitation (CPR) sustained for > 15 min after TCA. However, in 2013, a specific time-limit for terminating resuscitation was dropped, due to the lack of conclusive studies or data. We aimed to define the association between emergency medical services transport time and survival to demonstrate the survival curve of TCA. METHODS: A retrospective review of the Japan Trauma Data Bank. Inclusion criteria were age ≥ 16, at least one trauma with Abbreviated Injury Scale score (AIS) ≥ 3, and CPR performed in a prehospital setting. Exclusion criteria were burn injury, AIS score of 6 in any region, and missing data. Estimated survival rate and risk ratio for survival were analyzed according to transport time for all patients. Analysis was also performed separately on patients with sustained TCA at arrival. RESULTS: Of 292,027 patients in the database, 5336 were included in the study with 4141 sustained TCA. Their median age was 53 years (interquartile range (IQR) 36–70), and 67.2% were male. Their median Injury Severity Score was 29 (IQR 22–41), and median transport time was 11 min (IQR 6–17). Overall survival after TCA was 4.5%; however, survival of patients with sustained TCA at arrival was only 1.2%. The estimated survival rate and risk ratio for sustained TCA rapidly decreased after 15 min of transport time, with estimated survival falling below 1%. CONCLUSION: The chances of survival for sustained TCA declined rapidly while the patient is transported with CPR support. Time should be one reasonable factor for considering termination of resuscitation in patients with sustained TCA, although clinical signs of life, and type and severity of trauma should be taken into account clinically. BioMed Central 2021-09-16 /pmc/articles/PMC8447624/ /pubmed/34530735 http://dx.doi.org/10.1186/s12873-021-00499-z Text en © The Author(s) 2021 https://creativecommons.org/licenses/by/4.0/Open AccessThis article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/ (https://creativecommons.org/licenses/by/4.0/) . The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/ (https://creativecommons.org/publicdomain/zero/1.0/) ) applies to the data made available in this article, unless otherwise stated in a credit line to the data.
spellingShingle Research
Naito, Hiromichi
Yumoto, Tetsuya
Yorifuji, Takashi
Nojima, Tsuyoshi
Yamamoto, Hirotsugu
Yamada, Taihei
Tsukahara, Kohei
Inaba, Mototaka
Nishimura, Takeshi
Uehara, Takenori
Nakao, Atsunori
Association between emergency medical service transport time and survival in patients with traumatic cardiac arrest: a Nationwide retrospective observational study
title Association between emergency medical service transport time and survival in patients with traumatic cardiac arrest: a Nationwide retrospective observational study
title_full Association between emergency medical service transport time and survival in patients with traumatic cardiac arrest: a Nationwide retrospective observational study
title_fullStr Association between emergency medical service transport time and survival in patients with traumatic cardiac arrest: a Nationwide retrospective observational study
title_full_unstemmed Association between emergency medical service transport time and survival in patients with traumatic cardiac arrest: a Nationwide retrospective observational study
title_short Association between emergency medical service transport time and survival in patients with traumatic cardiac arrest: a Nationwide retrospective observational study
title_sort association between emergency medical service transport time and survival in patients with traumatic cardiac arrest: a nationwide retrospective observational study
topic Research
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8447624/
https://www.ncbi.nlm.nih.gov/pubmed/34530735
http://dx.doi.org/10.1186/s12873-021-00499-z
work_keys_str_mv AT naitohiromichi associationbetweenemergencymedicalservicetransporttimeandsurvivalinpatientswithtraumaticcardiacarrestanationwideretrospectiveobservationalstudy
AT yumototetsuya associationbetweenemergencymedicalservicetransporttimeandsurvivalinpatientswithtraumaticcardiacarrestanationwideretrospectiveobservationalstudy
AT yorifujitakashi associationbetweenemergencymedicalservicetransporttimeandsurvivalinpatientswithtraumaticcardiacarrestanationwideretrospectiveobservationalstudy
AT nojimatsuyoshi associationbetweenemergencymedicalservicetransporttimeandsurvivalinpatientswithtraumaticcardiacarrestanationwideretrospectiveobservationalstudy
AT yamamotohirotsugu associationbetweenemergencymedicalservicetransporttimeandsurvivalinpatientswithtraumaticcardiacarrestanationwideretrospectiveobservationalstudy
AT yamadataihei associationbetweenemergencymedicalservicetransporttimeandsurvivalinpatientswithtraumaticcardiacarrestanationwideretrospectiveobservationalstudy
AT tsukaharakohei associationbetweenemergencymedicalservicetransporttimeandsurvivalinpatientswithtraumaticcardiacarrestanationwideretrospectiveobservationalstudy
AT inabamototaka associationbetweenemergencymedicalservicetransporttimeandsurvivalinpatientswithtraumaticcardiacarrestanationwideretrospectiveobservationalstudy
AT nishimuratakeshi associationbetweenemergencymedicalservicetransporttimeandsurvivalinpatientswithtraumaticcardiacarrestanationwideretrospectiveobservationalstudy
AT ueharatakenori associationbetweenemergencymedicalservicetransporttimeandsurvivalinpatientswithtraumaticcardiacarrestanationwideretrospectiveobservationalstudy
AT nakaoatsunori associationbetweenemergencymedicalservicetransporttimeandsurvivalinpatientswithtraumaticcardiacarrestanationwideretrospectiveobservationalstudy