Cargando…
Playful strategies to foster the well-being of pediatric cancer patients in the Brazilian Unified Health System: a design thinking approach
BACKGROUND: Cancer care can negatively impact children’s subjective well-being. In this research, well-being refers to patients’ self-perception and encompasses their hospital and care delivery assessment. Playful strategies can stimulate treatment compliance and have been used to provide psychosoci...
Autores principales: | , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2021
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8449889/ https://www.ncbi.nlm.nih.gov/pubmed/34537025 http://dx.doi.org/10.1186/s12913-021-07018-7 |
_version_ | 1784569508585799680 |
---|---|
author | Tonetto, Leandro Miletto da Rosa, Valentina Marques Brust-Renck, Priscila Denham, Megan da Rosa, Pedro Marques Zimring, Craig Albanti, Irini Lehmann, Leslie |
author_facet | Tonetto, Leandro Miletto da Rosa, Valentina Marques Brust-Renck, Priscila Denham, Megan da Rosa, Pedro Marques Zimring, Craig Albanti, Irini Lehmann, Leslie |
author_sort | Tonetto, Leandro Miletto |
collection | PubMed |
description | BACKGROUND: Cancer care can negatively impact children’s subjective well-being. In this research, well-being refers to patients’ self-perception and encompasses their hospital and care delivery assessment. Playful strategies can stimulate treatment compliance and have been used to provide psychosocial support and health education; they can involve gamification, virtual reality, robotics, and healthcare environments. This study aims to identify how playfulness, whenever applicable, can be used as a strategy to improve the subjective well-being of pediatric cancer patients in the Brazilian Unified Health System. METHODS: Sixteen volunteers with experience in pediatric oncology participated in the study. They were physicians, psychologists, child life specialists, and design thinking professionals. They engaged in design thinking workshops to propose playful strategies to improve the well-being of pediatric cancer patients in the Brazilian Unified Health System. Data collection consisted of participatory observations. All activities were video recorded and analyzed through Thematic Analysis. The content generated by the volunteers was classified into two categories: impact of cancer care on children’s self-perception and children’s perceptions of the hospital and the care delivery. RESULTS: Volunteers developed strategies to help children deal with time at the hospital, hospital structure, and care delivery. Such strategies are not limited to using playfulness as a way of “having fun”; they privilege ludic interfaces, such as toys, to support psychosocial care and health education. They aim to address cancer and develop communication across families and staff in a humanized manner, educate families about the disease, and design children-friendly environments. Volunteers also generated strategies to help children cope with perceptions of death, pain, and their bodies. Such strategies aim to support understanding the meaning of life and death, comprehend pain beyond physicality, help re-signify cancer and children’s changing bodies, and give patients active voices during the treatment. CONCLUSIONS: The paper proposes strategies that can improve the well-being of pediatric cancer patients in the Brazilian Unified Health System. Such strategies connect children’s experiences as inpatients and outpatients and may inform the implementation of similar projects in other developing countries. |
format | Online Article Text |
id | pubmed-8449889 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2021 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-84498892021-09-20 Playful strategies to foster the well-being of pediatric cancer patients in the Brazilian Unified Health System: a design thinking approach Tonetto, Leandro Miletto da Rosa, Valentina Marques Brust-Renck, Priscila Denham, Megan da Rosa, Pedro Marques Zimring, Craig Albanti, Irini Lehmann, Leslie BMC Health Serv Res Research BACKGROUND: Cancer care can negatively impact children’s subjective well-being. In this research, well-being refers to patients’ self-perception and encompasses their hospital and care delivery assessment. Playful strategies can stimulate treatment compliance and have been used to provide psychosocial support and health education; they can involve gamification, virtual reality, robotics, and healthcare environments. This study aims to identify how playfulness, whenever applicable, can be used as a strategy to improve the subjective well-being of pediatric cancer patients in the Brazilian Unified Health System. METHODS: Sixteen volunteers with experience in pediatric oncology participated in the study. They were physicians, psychologists, child life specialists, and design thinking professionals. They engaged in design thinking workshops to propose playful strategies to improve the well-being of pediatric cancer patients in the Brazilian Unified Health System. Data collection consisted of participatory observations. All activities were video recorded and analyzed through Thematic Analysis. The content generated by the volunteers was classified into two categories: impact of cancer care on children’s self-perception and children’s perceptions of the hospital and the care delivery. RESULTS: Volunteers developed strategies to help children deal with time at the hospital, hospital structure, and care delivery. Such strategies are not limited to using playfulness as a way of “having fun”; they privilege ludic interfaces, such as toys, to support psychosocial care and health education. They aim to address cancer and develop communication across families and staff in a humanized manner, educate families about the disease, and design children-friendly environments. Volunteers also generated strategies to help children cope with perceptions of death, pain, and their bodies. Such strategies aim to support understanding the meaning of life and death, comprehend pain beyond physicality, help re-signify cancer and children’s changing bodies, and give patients active voices during the treatment. CONCLUSIONS: The paper proposes strategies that can improve the well-being of pediatric cancer patients in the Brazilian Unified Health System. Such strategies connect children’s experiences as inpatients and outpatients and may inform the implementation of similar projects in other developing countries. BioMed Central 2021-09-18 /pmc/articles/PMC8449889/ /pubmed/34537025 http://dx.doi.org/10.1186/s12913-021-07018-7 Text en © The Author(s) 2021 https://creativecommons.org/licenses/by/4.0/Open AccessThis article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/ (https://creativecommons.org/licenses/by/4.0/) . The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/ (https://creativecommons.org/publicdomain/zero/1.0/) ) applies to the data made available in this article, unless otherwise stated in a credit line to the data. |
spellingShingle | Research Tonetto, Leandro Miletto da Rosa, Valentina Marques Brust-Renck, Priscila Denham, Megan da Rosa, Pedro Marques Zimring, Craig Albanti, Irini Lehmann, Leslie Playful strategies to foster the well-being of pediatric cancer patients in the Brazilian Unified Health System: a design thinking approach |
title | Playful strategies to foster the well-being of pediatric cancer patients in the Brazilian Unified Health System: a design thinking approach |
title_full | Playful strategies to foster the well-being of pediatric cancer patients in the Brazilian Unified Health System: a design thinking approach |
title_fullStr | Playful strategies to foster the well-being of pediatric cancer patients in the Brazilian Unified Health System: a design thinking approach |
title_full_unstemmed | Playful strategies to foster the well-being of pediatric cancer patients in the Brazilian Unified Health System: a design thinking approach |
title_short | Playful strategies to foster the well-being of pediatric cancer patients in the Brazilian Unified Health System: a design thinking approach |
title_sort | playful strategies to foster the well-being of pediatric cancer patients in the brazilian unified health system: a design thinking approach |
topic | Research |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8449889/ https://www.ncbi.nlm.nih.gov/pubmed/34537025 http://dx.doi.org/10.1186/s12913-021-07018-7 |
work_keys_str_mv | AT tonettoleandromiletto playfulstrategiestofosterthewellbeingofpediatriccancerpatientsinthebrazilianunifiedhealthsystemadesignthinkingapproach AT darosavalentinamarques playfulstrategiestofosterthewellbeingofpediatriccancerpatientsinthebrazilianunifiedhealthsystemadesignthinkingapproach AT brustrenckpriscila playfulstrategiestofosterthewellbeingofpediatriccancerpatientsinthebrazilianunifiedhealthsystemadesignthinkingapproach AT denhammegan playfulstrategiestofosterthewellbeingofpediatriccancerpatientsinthebrazilianunifiedhealthsystemadesignthinkingapproach AT darosapedromarques playfulstrategiestofosterthewellbeingofpediatriccancerpatientsinthebrazilianunifiedhealthsystemadesignthinkingapproach AT zimringcraig playfulstrategiestofosterthewellbeingofpediatriccancerpatientsinthebrazilianunifiedhealthsystemadesignthinkingapproach AT albantiirini playfulstrategiestofosterthewellbeingofpediatriccancerpatientsinthebrazilianunifiedhealthsystemadesignthinkingapproach AT lehmannleslie playfulstrategiestofosterthewellbeingofpediatriccancerpatientsinthebrazilianunifiedhealthsystemadesignthinkingapproach |