Cargando…

Understanding Seizures and Prognosis of the Extreme Delta Brush Pattern in Anti-N-Methyl-D-Aspartate (NMDA) Receptor Encephalitis: A Systematic Review

Anti-N-methyl-d-aspartate (NMDA) receptor encephalitis (ANMDARE) is an autoimmune disorder with neurological and psychiatric features. The disease presents with a viral prodrome, followed by psychiatric manifestations. In the next phase, movement disorders or/and seizures occur. Finally, in the last...

Descripción completa

Detalles Bibliográficos
Autores principales: Parwani, Jashank, Ortiz, Juan Fernando, Alli, Ammar, Lalwani, Ayushi, Ruxmohan, Samir, Tamton, Hyder, Cuenca, Victor D, Gonzalez, Dina, Anwer, Fatima, Eissa-Garcés, Ahmed, Alzamora, Ivan Mateo, Paez, Maria
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Cureus 2021
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8460549/
https://www.ncbi.nlm.nih.gov/pubmed/34589370
http://dx.doi.org/10.7759/cureus.18154
_version_ 1784571780360306688
author Parwani, Jashank
Ortiz, Juan Fernando
Alli, Ammar
Lalwani, Ayushi
Ruxmohan, Samir
Tamton, Hyder
Cuenca, Victor D
Gonzalez, Dina
Anwer, Fatima
Eissa-Garcés, Ahmed
Alzamora, Ivan Mateo
Paez, Maria
author_facet Parwani, Jashank
Ortiz, Juan Fernando
Alli, Ammar
Lalwani, Ayushi
Ruxmohan, Samir
Tamton, Hyder
Cuenca, Victor D
Gonzalez, Dina
Anwer, Fatima
Eissa-Garcés, Ahmed
Alzamora, Ivan Mateo
Paez, Maria
author_sort Parwani, Jashank
collection PubMed
description Anti-N-methyl-d-aspartate (NMDA) receptor encephalitis (ANMDARE) is an autoimmune disorder with neurological and psychiatric features. The disease presents with a viral prodrome, followed by psychiatric manifestations. In the next phase, movement disorders or/and seizures occur. Finally, in the last phase, there is a decrease in the level of consciousness. Central hypoventilation and autonomic dysfunction can occur. Recently a unique EEG (electroencephalogram) pattern has been associated with anti-NMDA receptor encephalitis, the extreme delta brush (EDB). Although the association of the EDB with ANMDARE is known by the medical community, its significance is mainly unknown. A systematic review on NMDARE is also scarce. We decided to conduct a systematic review on this topic to consolidate the knowledge and establish the importance of the EDB as a prognostic factor. To conduct this systematic review, we used only studies conducted in humans, written in English, and published in the last 20 years. We used PubMed as a database and searched the following search terms: ("NMDA encephalitis"[Title/Abstract] AND "Epilepsy"[Title/Abstract]) OR (NMDA encephalitis"[Title/Abstract] AND "seizures" [Title/Abstract]) OR ("NMDA encephalitis"[Title/Abstract] AND "extreme delta brush"[Title/Abstract]). The protocol used for this systematic review was the Meta-analyses Of Observational Studies in Epidemiology (MOOSE) protocol, and to analyze the bias of the studies, we used the ROBINS-1 tool. Eight studies were collected from our search strategy. Our data pulling showed that seizures were present in 178/249 (71.48%) patients. Status Epilepticus was reported in 29/96 (30.20%), and the EBD was seen in 30.89% (55/178) patients with seizures. The range of EDB was 5.9%-33% among the studies. Because the sample size was small, the statistical power was decreased. We had a low overall risk of bias. The wide range in the results could be related to the timing of the EEG recording. EDB was associated overall with increased length of hospital stay, increased ICU admission, and incidence of status epilepticus. The etiology of the EDB remains mainly unknown. However, it has been postulated that in NMDAR encephalitis, there is a disruption of the rhythmic neuronal activity. When antibodies block/target the NMDAR, the rhythmic neuronal activity is disrupted, leading to the unique EDB pattern. Another theory suggests that delta activity is caused because of focal abnormalities in the brain, and the superimposition of the beta waves is related to the alterations of the NMDA receptors.
format Online
Article
Text
id pubmed-8460549
institution National Center for Biotechnology Information
language English
publishDate 2021
publisher Cureus
record_format MEDLINE/PubMed
spelling pubmed-84605492021-09-28 Understanding Seizures and Prognosis of the Extreme Delta Brush Pattern in Anti-N-Methyl-D-Aspartate (NMDA) Receptor Encephalitis: A Systematic Review Parwani, Jashank Ortiz, Juan Fernando Alli, Ammar Lalwani, Ayushi Ruxmohan, Samir Tamton, Hyder Cuenca, Victor D Gonzalez, Dina Anwer, Fatima Eissa-Garcés, Ahmed Alzamora, Ivan Mateo Paez, Maria Cureus Neurology Anti-N-methyl-d-aspartate (NMDA) receptor encephalitis (ANMDARE) is an autoimmune disorder with neurological and psychiatric features. The disease presents with a viral prodrome, followed by psychiatric manifestations. In the next phase, movement disorders or/and seizures occur. Finally, in the last phase, there is a decrease in the level of consciousness. Central hypoventilation and autonomic dysfunction can occur. Recently a unique EEG (electroencephalogram) pattern has been associated with anti-NMDA receptor encephalitis, the extreme delta brush (EDB). Although the association of the EDB with ANMDARE is known by the medical community, its significance is mainly unknown. A systematic review on NMDARE is also scarce. We decided to conduct a systematic review on this topic to consolidate the knowledge and establish the importance of the EDB as a prognostic factor. To conduct this systematic review, we used only studies conducted in humans, written in English, and published in the last 20 years. We used PubMed as a database and searched the following search terms: ("NMDA encephalitis"[Title/Abstract] AND "Epilepsy"[Title/Abstract]) OR (NMDA encephalitis"[Title/Abstract] AND "seizures" [Title/Abstract]) OR ("NMDA encephalitis"[Title/Abstract] AND "extreme delta brush"[Title/Abstract]). The protocol used for this systematic review was the Meta-analyses Of Observational Studies in Epidemiology (MOOSE) protocol, and to analyze the bias of the studies, we used the ROBINS-1 tool. Eight studies were collected from our search strategy. Our data pulling showed that seizures were present in 178/249 (71.48%) patients. Status Epilepticus was reported in 29/96 (30.20%), and the EBD was seen in 30.89% (55/178) patients with seizures. The range of EDB was 5.9%-33% among the studies. Because the sample size was small, the statistical power was decreased. We had a low overall risk of bias. The wide range in the results could be related to the timing of the EEG recording. EDB was associated overall with increased length of hospital stay, increased ICU admission, and incidence of status epilepticus. The etiology of the EDB remains mainly unknown. However, it has been postulated that in NMDAR encephalitis, there is a disruption of the rhythmic neuronal activity. When antibodies block/target the NMDAR, the rhythmic neuronal activity is disrupted, leading to the unique EDB pattern. Another theory suggests that delta activity is caused because of focal abnormalities in the brain, and the superimposition of the beta waves is related to the alterations of the NMDA receptors. Cureus 2021-09-21 /pmc/articles/PMC8460549/ /pubmed/34589370 http://dx.doi.org/10.7759/cureus.18154 Text en Copyright © 2021, Parwani et al. https://creativecommons.org/licenses/by/3.0/This is an open access article distributed under the terms of the Creative Commons Attribution License, which permits unrestricted use, distribution, and reproduction in any medium, provided the original author and source are credited.
spellingShingle Neurology
Parwani, Jashank
Ortiz, Juan Fernando
Alli, Ammar
Lalwani, Ayushi
Ruxmohan, Samir
Tamton, Hyder
Cuenca, Victor D
Gonzalez, Dina
Anwer, Fatima
Eissa-Garcés, Ahmed
Alzamora, Ivan Mateo
Paez, Maria
Understanding Seizures and Prognosis of the Extreme Delta Brush Pattern in Anti-N-Methyl-D-Aspartate (NMDA) Receptor Encephalitis: A Systematic Review
title Understanding Seizures and Prognosis of the Extreme Delta Brush Pattern in Anti-N-Methyl-D-Aspartate (NMDA) Receptor Encephalitis: A Systematic Review
title_full Understanding Seizures and Prognosis of the Extreme Delta Brush Pattern in Anti-N-Methyl-D-Aspartate (NMDA) Receptor Encephalitis: A Systematic Review
title_fullStr Understanding Seizures and Prognosis of the Extreme Delta Brush Pattern in Anti-N-Methyl-D-Aspartate (NMDA) Receptor Encephalitis: A Systematic Review
title_full_unstemmed Understanding Seizures and Prognosis of the Extreme Delta Brush Pattern in Anti-N-Methyl-D-Aspartate (NMDA) Receptor Encephalitis: A Systematic Review
title_short Understanding Seizures and Prognosis of the Extreme Delta Brush Pattern in Anti-N-Methyl-D-Aspartate (NMDA) Receptor Encephalitis: A Systematic Review
title_sort understanding seizures and prognosis of the extreme delta brush pattern in anti-n-methyl-d-aspartate (nmda) receptor encephalitis: a systematic review
topic Neurology
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8460549/
https://www.ncbi.nlm.nih.gov/pubmed/34589370
http://dx.doi.org/10.7759/cureus.18154
work_keys_str_mv AT parwanijashank understandingseizuresandprognosisoftheextremedeltabrushpatterninantinmethyldaspartatenmdareceptorencephalitisasystematicreview
AT ortizjuanfernando understandingseizuresandprognosisoftheextremedeltabrushpatterninantinmethyldaspartatenmdareceptorencephalitisasystematicreview
AT alliammar understandingseizuresandprognosisoftheextremedeltabrushpatterninantinmethyldaspartatenmdareceptorencephalitisasystematicreview
AT lalwaniayushi understandingseizuresandprognosisoftheextremedeltabrushpatterninantinmethyldaspartatenmdareceptorencephalitisasystematicreview
AT ruxmohansamir understandingseizuresandprognosisoftheextremedeltabrushpatterninantinmethyldaspartatenmdareceptorencephalitisasystematicreview
AT tamtonhyder understandingseizuresandprognosisoftheextremedeltabrushpatterninantinmethyldaspartatenmdareceptorencephalitisasystematicreview
AT cuencavictord understandingseizuresandprognosisoftheextremedeltabrushpatterninantinmethyldaspartatenmdareceptorencephalitisasystematicreview
AT gonzalezdina understandingseizuresandprognosisoftheextremedeltabrushpatterninantinmethyldaspartatenmdareceptorencephalitisasystematicreview
AT anwerfatima understandingseizuresandprognosisoftheextremedeltabrushpatterninantinmethyldaspartatenmdareceptorencephalitisasystematicreview
AT eissagarcesahmed understandingseizuresandprognosisoftheextremedeltabrushpatterninantinmethyldaspartatenmdareceptorencephalitisasystematicreview
AT alzamoraivanmateo understandingseizuresandprognosisoftheextremedeltabrushpatterninantinmethyldaspartatenmdareceptorencephalitisasystematicreview
AT paezmaria understandingseizuresandprognosisoftheextremedeltabrushpatterninantinmethyldaspartatenmdareceptorencephalitisasystematicreview