Cargando…
Association Between Retinoid X Receptor Gene Variants and Dyslipidemia Risk in an Iranian Population
Background Dyslipidemia is a complex trait that is influenced by various genetic and environmental factors. While the exact cause of dyslipidemia is still unknown, some studies have shown that genetic factors such as single nucleotide polymorphisms (SNPs) have been primarily associated with dyslipid...
Autores principales: | , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Cureus
2021
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8491560/ https://www.ncbi.nlm.nih.gov/pubmed/34659944 http://dx.doi.org/10.7759/cureus.17730 |
_version_ | 1784578755582230528 |
---|---|
author | Vafaeie, Farzane Kazemi, Toba Khosravi, Saeede Miri Moghaddam, Ebrahim |
author_facet | Vafaeie, Farzane Kazemi, Toba Khosravi, Saeede Miri Moghaddam, Ebrahim |
author_sort | Vafaeie, Farzane |
collection | PubMed |
description | Background Dyslipidemia is a complex trait that is influenced by various genetic and environmental factors. While the exact cause of dyslipidemia is still unknown, some studies have shown that genetic factors such as single nucleotide polymorphisms (SNPs) have been primarily associated with dyslipidemia. Based on the available data, it appears that retinoid X receptor (RXR) genes are jointly or separately associated with lipid homeostasis and that SNPs may affect RXR gene functions in lipid metabolism. Methods To study the possible role of the RXR genes in genetic susceptibility of dyslipidemia, three selected polymorphisms, rs3132294 located in RXRA (RXR-alpha) gene and rs2651860 and rs1128977 located in RXRG (RXR-gamma) gene, were investigated in 391 individuals with the use of tetra-primer amplification refractory mutation system polymerase chain reaction (T-ARMS PCR) method. Results For the rs3132294 SNP, the genotype frequencies in the case group were GG 58.5%, GA 33.2%, and AA 8.3%, and in the control group, they were GG 51.8%, GA 36.3%, and AA 11.9%. The genotype distribution of rs2651860 SNP in the case group were TT 43.2%, TG 52.1%, and GG 4.7%, and in the control group, they were TT 50.8%, TG 46.2%, and GG 3%. Genotype frequencies for the rs1128977 SNP in the case group were CC 34.7%, CT 47.6% and TT 17.7%, compared with CC 37.8%, CT 44.3%, and TT 17.9% in the control group. When the clinical characteristics of the case and control groups were stratified by allele carrier status for each SNP, the rs1128977 SNP was associated with increased levels of HDL-cholesterol, body mass index, waist circumference, and diastolic blood pressure (P< 0.05). In contrast, the alleles of the rs2651860 and rs3132294 SNP were not associated with an increased prevalence of dyslipidemia or clinical characteristics in the case group compared to the control group. Conclusion The present study suggests that rs1128977 SNP in the RXRG gene may affect the clinical characteristics in cases. However, further genetics association studies on large samples are required to validate our findings. |
format | Online Article Text |
id | pubmed-8491560 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2021 |
publisher | Cureus |
record_format | MEDLINE/PubMed |
spelling | pubmed-84915602021-10-14 Association Between Retinoid X Receptor Gene Variants and Dyslipidemia Risk in an Iranian Population Vafaeie, Farzane Kazemi, Toba Khosravi, Saeede Miri Moghaddam, Ebrahim Cureus Genetics Background Dyslipidemia is a complex trait that is influenced by various genetic and environmental factors. While the exact cause of dyslipidemia is still unknown, some studies have shown that genetic factors such as single nucleotide polymorphisms (SNPs) have been primarily associated with dyslipidemia. Based on the available data, it appears that retinoid X receptor (RXR) genes are jointly or separately associated with lipid homeostasis and that SNPs may affect RXR gene functions in lipid metabolism. Methods To study the possible role of the RXR genes in genetic susceptibility of dyslipidemia, three selected polymorphisms, rs3132294 located in RXRA (RXR-alpha) gene and rs2651860 and rs1128977 located in RXRG (RXR-gamma) gene, were investigated in 391 individuals with the use of tetra-primer amplification refractory mutation system polymerase chain reaction (T-ARMS PCR) method. Results For the rs3132294 SNP, the genotype frequencies in the case group were GG 58.5%, GA 33.2%, and AA 8.3%, and in the control group, they were GG 51.8%, GA 36.3%, and AA 11.9%. The genotype distribution of rs2651860 SNP in the case group were TT 43.2%, TG 52.1%, and GG 4.7%, and in the control group, they were TT 50.8%, TG 46.2%, and GG 3%. Genotype frequencies for the rs1128977 SNP in the case group were CC 34.7%, CT 47.6% and TT 17.7%, compared with CC 37.8%, CT 44.3%, and TT 17.9% in the control group. When the clinical characteristics of the case and control groups were stratified by allele carrier status for each SNP, the rs1128977 SNP was associated with increased levels of HDL-cholesterol, body mass index, waist circumference, and diastolic blood pressure (P< 0.05). In contrast, the alleles of the rs2651860 and rs3132294 SNP were not associated with an increased prevalence of dyslipidemia or clinical characteristics in the case group compared to the control group. Conclusion The present study suggests that rs1128977 SNP in the RXRG gene may affect the clinical characteristics in cases. However, further genetics association studies on large samples are required to validate our findings. Cureus 2021-09-05 /pmc/articles/PMC8491560/ /pubmed/34659944 http://dx.doi.org/10.7759/cureus.17730 Text en Copyright © 2021, Vafaeie et al. https://creativecommons.org/licenses/by/3.0/This is an open access article distributed under the terms of the Creative Commons Attribution License, which permits unrestricted use, distribution, and reproduction in any medium, provided the original author and source are credited. |
spellingShingle | Genetics Vafaeie, Farzane Kazemi, Toba Khosravi, Saeede Miri Moghaddam, Ebrahim Association Between Retinoid X Receptor Gene Variants and Dyslipidemia Risk in an Iranian Population |
title | Association Between Retinoid X Receptor Gene Variants and Dyslipidemia Risk in an Iranian Population |
title_full | Association Between Retinoid X Receptor Gene Variants and Dyslipidemia Risk in an Iranian Population |
title_fullStr | Association Between Retinoid X Receptor Gene Variants and Dyslipidemia Risk in an Iranian Population |
title_full_unstemmed | Association Between Retinoid X Receptor Gene Variants and Dyslipidemia Risk in an Iranian Population |
title_short | Association Between Retinoid X Receptor Gene Variants and Dyslipidemia Risk in an Iranian Population |
title_sort | association between retinoid x receptor gene variants and dyslipidemia risk in an iranian population |
topic | Genetics |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8491560/ https://www.ncbi.nlm.nih.gov/pubmed/34659944 http://dx.doi.org/10.7759/cureus.17730 |
work_keys_str_mv | AT vafaeiefarzane associationbetweenretinoidxreceptorgenevariantsanddyslipidemiariskinaniranianpopulation AT kazemitoba associationbetweenretinoidxreceptorgenevariantsanddyslipidemiariskinaniranianpopulation AT khosravisaeede associationbetweenretinoidxreceptorgenevariantsanddyslipidemiariskinaniranianpopulation AT mirimoghaddamebrahim associationbetweenretinoidxreceptorgenevariantsanddyslipidemiariskinaniranianpopulation |