Cargando…
Profiling of DNA damage and repair pathways in small cell lung cancer reveals a suppressive role in the immune landscape
| Autores principales: | , , , , , , , , , |
|---|---|
| Formato: | Online Artículo Texto |
| Lenguaje: | English |
| Publicado: |
BioMed Central
2021
|
| Materias: | |
| Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8496044/ https://www.ncbi.nlm.nih.gov/pubmed/34620176 http://dx.doi.org/10.1186/s12943-021-01432-5 |
| _version_ | 1784579677902340096 |
|---|---|
| author | Jin, Renjing Liu, Bin Yu, Mengjun Song, Liwei Gu, Meng Wang, Ziyu Li, Xiaobo Zhang, Xu Wang, Jinghui Ma, Teng |
| author_facet | Jin, Renjing Liu, Bin Yu, Mengjun Song, Liwei Gu, Meng Wang, Ziyu Li, Xiaobo Zhang, Xu Wang, Jinghui Ma, Teng |
| author_sort | Jin, Renjing |
| collection | PubMed |
| description | |
| format | Online Article Text |
| id | pubmed-8496044 |
| institution | National Center for Biotechnology Information |
| language | English |
| publishDate | 2021 |
| publisher | BioMed Central |
| record_format | MEDLINE/PubMed |
| spelling | pubmed-84960442021-10-07 Profiling of DNA damage and repair pathways in small cell lung cancer reveals a suppressive role in the immune landscape Jin, Renjing Liu, Bin Yu, Mengjun Song, Liwei Gu, Meng Wang, Ziyu Li, Xiaobo Zhang, Xu Wang, Jinghui Ma, Teng Mol Cancer Letter to the Editor BioMed Central 2021-10-07 /pmc/articles/PMC8496044/ /pubmed/34620176 http://dx.doi.org/10.1186/s12943-021-01432-5 Text en © The Author(s) 2021 https://creativecommons.org/licenses/by/4.0/Open AccessThis article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/ (https://creativecommons.org/licenses/by/4.0/) . The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/ (https://creativecommons.org/publicdomain/zero/1.0/) ) applies to the data made available in this article, unless otherwise stated in a credit line to the data. |
| spellingShingle | Letter to the Editor Jin, Renjing Liu, Bin Yu, Mengjun Song, Liwei Gu, Meng Wang, Ziyu Li, Xiaobo Zhang, Xu Wang, Jinghui Ma, Teng Profiling of DNA damage and repair pathways in small cell lung cancer reveals a suppressive role in the immune landscape |
| title | Profiling of DNA damage and repair pathways in small cell lung cancer reveals a suppressive role in the immune landscape |
| title_full | Profiling of DNA damage and repair pathways in small cell lung cancer reveals a suppressive role in the immune landscape |
| title_fullStr | Profiling of DNA damage and repair pathways in small cell lung cancer reveals a suppressive role in the immune landscape |
| title_full_unstemmed | Profiling of DNA damage and repair pathways in small cell lung cancer reveals a suppressive role in the immune landscape |
| title_short | Profiling of DNA damage and repair pathways in small cell lung cancer reveals a suppressive role in the immune landscape |
| title_sort | profiling of dna damage and repair pathways in small cell lung cancer reveals a suppressive role in the immune landscape |
| topic | Letter to the Editor |
| url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8496044/ https://www.ncbi.nlm.nih.gov/pubmed/34620176 http://dx.doi.org/10.1186/s12943-021-01432-5 |
| work_keys_str_mv | AT jinrenjing profilingofdnadamageandrepairpathwaysinsmallcelllungcancerrevealsasuppressiveroleintheimmunelandscape AT liubin profilingofdnadamageandrepairpathwaysinsmallcelllungcancerrevealsasuppressiveroleintheimmunelandscape AT yumengjun profilingofdnadamageandrepairpathwaysinsmallcelllungcancerrevealsasuppressiveroleintheimmunelandscape AT songliwei profilingofdnadamageandrepairpathwaysinsmallcelllungcancerrevealsasuppressiveroleintheimmunelandscape AT gumeng profilingofdnadamageandrepairpathwaysinsmallcelllungcancerrevealsasuppressiveroleintheimmunelandscape AT wangziyu profilingofdnadamageandrepairpathwaysinsmallcelllungcancerrevealsasuppressiveroleintheimmunelandscape AT lixiaobo profilingofdnadamageandrepairpathwaysinsmallcelllungcancerrevealsasuppressiveroleintheimmunelandscape AT zhangxu profilingofdnadamageandrepairpathwaysinsmallcelllungcancerrevealsasuppressiveroleintheimmunelandscape AT wangjinghui profilingofdnadamageandrepairpathwaysinsmallcelllungcancerrevealsasuppressiveroleintheimmunelandscape AT mateng profilingofdnadamageandrepairpathwaysinsmallcelllungcancerrevealsasuppressiveroleintheimmunelandscape |