Cargando…
Genetic association of FMRP targets with psychiatric disorders
Genes encoding the mRNA targets of fragile X mental retardation protein (FMRP) are enriched for genetic association with psychiatric disorders. However, many FMRP targets possess functions that are themselves genetically associated with psychiatric disorders, including synaptic transmission and plas...
Autores principales: | , , , , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Nature Publishing Group UK
2020
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8505260/ https://www.ncbi.nlm.nih.gov/pubmed/33077856 http://dx.doi.org/10.1038/s41380-020-00912-2 |
_version_ | 1784581496435113984 |
---|---|
author | Clifton, Nicholas E. Rees, Elliott Holmans, Peter A. Pardiñas, Antonio F. Harwood, Janet C. Di Florio, Arianna Kirov, George Walters, James T. R. O’Donovan, Michael C. Owen, Michael J. Hall, Jeremy Pocklington, Andrew J. |
author_facet | Clifton, Nicholas E. Rees, Elliott Holmans, Peter A. Pardiñas, Antonio F. Harwood, Janet C. Di Florio, Arianna Kirov, George Walters, James T. R. O’Donovan, Michael C. Owen, Michael J. Hall, Jeremy Pocklington, Andrew J. |
author_sort | Clifton, Nicholas E. |
collection | PubMed |
description | Genes encoding the mRNA targets of fragile X mental retardation protein (FMRP) are enriched for genetic association with psychiatric disorders. However, many FMRP targets possess functions that are themselves genetically associated with psychiatric disorders, including synaptic transmission and plasticity, making it unclear whether the genetic risk is truly related to binding by FMRP or is alternatively mediated by the sampling of genes better characterised by another trait or functional annotation. Using published common variant, rare coding variant and copy number variant data, we examined the relationship between FMRP binding and genetic association with schizophrenia, major depressive disorder and bipolar disorder. High-confidence targets of FMRP, derived from studies of multiple tissue types, were enriched for common schizophrenia risk alleles, as well as rare loss-of-function and de novo nonsynonymous variants in schizophrenia cases. Similarly, through common variation, FMRP targets were associated with major depressive disorder, and we present novel evidence of association with bipolar disorder. These relationships could not be explained by other functional annotations known to be associated with psychiatric disorders, including those related to synaptic structure and function. This study reinforces the evidence that targeting by FMRP captures a subpopulation of genes enriched for genetic association with a range of psychiatric disorders. |
format | Online Article Text |
id | pubmed-8505260 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2020 |
publisher | Nature Publishing Group UK |
record_format | MEDLINE/PubMed |
spelling | pubmed-85052602021-10-14 Genetic association of FMRP targets with psychiatric disorders Clifton, Nicholas E. Rees, Elliott Holmans, Peter A. Pardiñas, Antonio F. Harwood, Janet C. Di Florio, Arianna Kirov, George Walters, James T. R. O’Donovan, Michael C. Owen, Michael J. Hall, Jeremy Pocklington, Andrew J. Mol Psychiatry Article Genes encoding the mRNA targets of fragile X mental retardation protein (FMRP) are enriched for genetic association with psychiatric disorders. However, many FMRP targets possess functions that are themselves genetically associated with psychiatric disorders, including synaptic transmission and plasticity, making it unclear whether the genetic risk is truly related to binding by FMRP or is alternatively mediated by the sampling of genes better characterised by another trait or functional annotation. Using published common variant, rare coding variant and copy number variant data, we examined the relationship between FMRP binding and genetic association with schizophrenia, major depressive disorder and bipolar disorder. High-confidence targets of FMRP, derived from studies of multiple tissue types, were enriched for common schizophrenia risk alleles, as well as rare loss-of-function and de novo nonsynonymous variants in schizophrenia cases. Similarly, through common variation, FMRP targets were associated with major depressive disorder, and we present novel evidence of association with bipolar disorder. These relationships could not be explained by other functional annotations known to be associated with psychiatric disorders, including those related to synaptic structure and function. This study reinforces the evidence that targeting by FMRP captures a subpopulation of genes enriched for genetic association with a range of psychiatric disorders. Nature Publishing Group UK 2020-10-19 2021 /pmc/articles/PMC8505260/ /pubmed/33077856 http://dx.doi.org/10.1038/s41380-020-00912-2 Text en © The Author(s) 2020 https://creativecommons.org/licenses/by/4.0/Open Access This article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The images or other third party material in this article are included in the article’s Creative Commons license, unless indicated otherwise in a credit line to the material. If material is not included in the article’s Creative Commons license and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this license, visit http://creativecommons.org/licenses/by/4.0/ (https://creativecommons.org/licenses/by/4.0/) . |
spellingShingle | Article Clifton, Nicholas E. Rees, Elliott Holmans, Peter A. Pardiñas, Antonio F. Harwood, Janet C. Di Florio, Arianna Kirov, George Walters, James T. R. O’Donovan, Michael C. Owen, Michael J. Hall, Jeremy Pocklington, Andrew J. Genetic association of FMRP targets with psychiatric disorders |
title | Genetic association of FMRP targets with psychiatric disorders |
title_full | Genetic association of FMRP targets with psychiatric disorders |
title_fullStr | Genetic association of FMRP targets with psychiatric disorders |
title_full_unstemmed | Genetic association of FMRP targets with psychiatric disorders |
title_short | Genetic association of FMRP targets with psychiatric disorders |
title_sort | genetic association of fmrp targets with psychiatric disorders |
topic | Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8505260/ https://www.ncbi.nlm.nih.gov/pubmed/33077856 http://dx.doi.org/10.1038/s41380-020-00912-2 |
work_keys_str_mv | AT cliftonnicholase geneticassociationoffmrptargetswithpsychiatricdisorders AT reeselliott geneticassociationoffmrptargetswithpsychiatricdisorders AT holmanspetera geneticassociationoffmrptargetswithpsychiatricdisorders AT pardinasantoniof geneticassociationoffmrptargetswithpsychiatricdisorders AT harwoodjanetc geneticassociationoffmrptargetswithpsychiatricdisorders AT diflorioarianna geneticassociationoffmrptargetswithpsychiatricdisorders AT kirovgeorge geneticassociationoffmrptargetswithpsychiatricdisorders AT waltersjamestr geneticassociationoffmrptargetswithpsychiatricdisorders AT odonovanmichaelc geneticassociationoffmrptargetswithpsychiatricdisorders AT owenmichaelj geneticassociationoffmrptargetswithpsychiatricdisorders AT halljeremy geneticassociationoffmrptargetswithpsychiatricdisorders AT pocklingtonandrewj geneticassociationoffmrptargetswithpsychiatricdisorders |