Cargando…

Genetic association of FMRP targets with psychiatric disorders

Genes encoding the mRNA targets of fragile X mental retardation protein (FMRP) are enriched for genetic association with psychiatric disorders. However, many FMRP targets possess functions that are themselves genetically associated with psychiatric disorders, including synaptic transmission and plas...

Descripción completa

Detalles Bibliográficos
Autores principales: Clifton, Nicholas E., Rees, Elliott, Holmans, Peter A., Pardiñas, Antonio F., Harwood, Janet C., Di Florio, Arianna, Kirov, George, Walters, James T. R., O’Donovan, Michael C., Owen, Michael J., Hall, Jeremy, Pocklington, Andrew J.
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Nature Publishing Group UK 2020
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8505260/
https://www.ncbi.nlm.nih.gov/pubmed/33077856
http://dx.doi.org/10.1038/s41380-020-00912-2
_version_ 1784581496435113984
author Clifton, Nicholas E.
Rees, Elliott
Holmans, Peter A.
Pardiñas, Antonio F.
Harwood, Janet C.
Di Florio, Arianna
Kirov, George
Walters, James T. R.
O’Donovan, Michael C.
Owen, Michael J.
Hall, Jeremy
Pocklington, Andrew J.
author_facet Clifton, Nicholas E.
Rees, Elliott
Holmans, Peter A.
Pardiñas, Antonio F.
Harwood, Janet C.
Di Florio, Arianna
Kirov, George
Walters, James T. R.
O’Donovan, Michael C.
Owen, Michael J.
Hall, Jeremy
Pocklington, Andrew J.
author_sort Clifton, Nicholas E.
collection PubMed
description Genes encoding the mRNA targets of fragile X mental retardation protein (FMRP) are enriched for genetic association with psychiatric disorders. However, many FMRP targets possess functions that are themselves genetically associated with psychiatric disorders, including synaptic transmission and plasticity, making it unclear whether the genetic risk is truly related to binding by FMRP or is alternatively mediated by the sampling of genes better characterised by another trait or functional annotation. Using published common variant, rare coding variant and copy number variant data, we examined the relationship between FMRP binding and genetic association with schizophrenia, major depressive disorder and bipolar disorder. High-confidence targets of FMRP, derived from studies of multiple tissue types, were enriched for common schizophrenia risk alleles, as well as rare loss-of-function and de novo nonsynonymous variants in schizophrenia cases. Similarly, through common variation, FMRP targets were associated with major depressive disorder, and we present novel evidence of association with bipolar disorder. These relationships could not be explained by other functional annotations known to be associated with psychiatric disorders, including those related to synaptic structure and function. This study reinforces the evidence that targeting by FMRP captures a subpopulation of genes enriched for genetic association with a range of psychiatric disorders.
format Online
Article
Text
id pubmed-8505260
institution National Center for Biotechnology Information
language English
publishDate 2020
publisher Nature Publishing Group UK
record_format MEDLINE/PubMed
spelling pubmed-85052602021-10-14 Genetic association of FMRP targets with psychiatric disorders Clifton, Nicholas E. Rees, Elliott Holmans, Peter A. Pardiñas, Antonio F. Harwood, Janet C. Di Florio, Arianna Kirov, George Walters, James T. R. O’Donovan, Michael C. Owen, Michael J. Hall, Jeremy Pocklington, Andrew J. Mol Psychiatry Article Genes encoding the mRNA targets of fragile X mental retardation protein (FMRP) are enriched for genetic association with psychiatric disorders. However, many FMRP targets possess functions that are themselves genetically associated with psychiatric disorders, including synaptic transmission and plasticity, making it unclear whether the genetic risk is truly related to binding by FMRP or is alternatively mediated by the sampling of genes better characterised by another trait or functional annotation. Using published common variant, rare coding variant and copy number variant data, we examined the relationship between FMRP binding and genetic association with schizophrenia, major depressive disorder and bipolar disorder. High-confidence targets of FMRP, derived from studies of multiple tissue types, were enriched for common schizophrenia risk alleles, as well as rare loss-of-function and de novo nonsynonymous variants in schizophrenia cases. Similarly, through common variation, FMRP targets were associated with major depressive disorder, and we present novel evidence of association with bipolar disorder. These relationships could not be explained by other functional annotations known to be associated with psychiatric disorders, including those related to synaptic structure and function. This study reinforces the evidence that targeting by FMRP captures a subpopulation of genes enriched for genetic association with a range of psychiatric disorders. Nature Publishing Group UK 2020-10-19 2021 /pmc/articles/PMC8505260/ /pubmed/33077856 http://dx.doi.org/10.1038/s41380-020-00912-2 Text en © The Author(s) 2020 https://creativecommons.org/licenses/by/4.0/Open Access This article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The images or other third party material in this article are included in the article’s Creative Commons license, unless indicated otherwise in a credit line to the material. If material is not included in the article’s Creative Commons license and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this license, visit http://creativecommons.org/licenses/by/4.0/ (https://creativecommons.org/licenses/by/4.0/) .
spellingShingle Article
Clifton, Nicholas E.
Rees, Elliott
Holmans, Peter A.
Pardiñas, Antonio F.
Harwood, Janet C.
Di Florio, Arianna
Kirov, George
Walters, James T. R.
O’Donovan, Michael C.
Owen, Michael J.
Hall, Jeremy
Pocklington, Andrew J.
Genetic association of FMRP targets with psychiatric disorders
title Genetic association of FMRP targets with psychiatric disorders
title_full Genetic association of FMRP targets with psychiatric disorders
title_fullStr Genetic association of FMRP targets with psychiatric disorders
title_full_unstemmed Genetic association of FMRP targets with psychiatric disorders
title_short Genetic association of FMRP targets with psychiatric disorders
title_sort genetic association of fmrp targets with psychiatric disorders
topic Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8505260/
https://www.ncbi.nlm.nih.gov/pubmed/33077856
http://dx.doi.org/10.1038/s41380-020-00912-2
work_keys_str_mv AT cliftonnicholase geneticassociationoffmrptargetswithpsychiatricdisorders
AT reeselliott geneticassociationoffmrptargetswithpsychiatricdisorders
AT holmanspetera geneticassociationoffmrptargetswithpsychiatricdisorders
AT pardinasantoniof geneticassociationoffmrptargetswithpsychiatricdisorders
AT harwoodjanetc geneticassociationoffmrptargetswithpsychiatricdisorders
AT diflorioarianna geneticassociationoffmrptargetswithpsychiatricdisorders
AT kirovgeorge geneticassociationoffmrptargetswithpsychiatricdisorders
AT waltersjamestr geneticassociationoffmrptargetswithpsychiatricdisorders
AT odonovanmichaelc geneticassociationoffmrptargetswithpsychiatricdisorders
AT owenmichaelj geneticassociationoffmrptargetswithpsychiatricdisorders
AT halljeremy geneticassociationoffmrptargetswithpsychiatricdisorders
AT pocklingtonandrewj geneticassociationoffmrptargetswithpsychiatricdisorders