Cargando…

The complete chloroplast genome of Carex agglomerata C. B. Clarke (Cyperaceae), an endemic species from China

Carex agglomerata C. B. Clarke is a sedge with excellent ornamental characters, it is an important ecosystem stabilizer. Here we report the complete chloroplast genome of C. agglomerata to provide a foundation for further phylogenetic studies on the Cyperaceae. The chloroplast (cp) genome is 184,157...

Descripción completa

Detalles Bibliográficos
Autores principales: Xun, Lu-Lu, Ding, Fang-Bin, Chen, Chen, Liu, Pei-Liang, Lu, Yuan, Zhou, Ya-Fu, Zhang, Ya-Wei, Li, Si-Feng
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Taylor & Francis 2021
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8510598/
https://www.ncbi.nlm.nih.gov/pubmed/34651074
http://dx.doi.org/10.1080/23802359.2021.1984326
_version_ 1784582608679600128
author Xun, Lu-Lu
Ding, Fang-Bin
Chen, Chen
Liu, Pei-Liang
Lu, Yuan
Zhou, Ya-Fu
Zhang, Ya-Wei
Li, Si-Feng
author_facet Xun, Lu-Lu
Ding, Fang-Bin
Chen, Chen
Liu, Pei-Liang
Lu, Yuan
Zhou, Ya-Fu
Zhang, Ya-Wei
Li, Si-Feng
author_sort Xun, Lu-Lu
collection PubMed
description Carex agglomerata C. B. Clarke is a sedge with excellent ornamental characters, it is an important ecosystem stabilizer. Here we report the complete chloroplast genome of C. agglomerata to provide a foundation for further phylogenetic studies on the Cyperaceae. The chloroplast (cp) genome is 184,157 bp in size and consists of a large single-copy (LSC) region 106,654 bp in length, a small single-copy (SSC) region of 36,099 bp, two inverted repeats (IR) regions each 20,702 bp. The total GC content of the cp genome is 33.9% with the LSC, SSC, and IR regions 32, 32.5, and 42.9%, respectively. The cp genome contains 128 genes, including 80 protein-coding, 40 tRNA, and eight rRNA genes. The phylogenetic analysis showed C. agglomerata is in a clade with Carex neurocarpa Maxim and Carex siderosticta Hance. This study provides a basis for further phylogenetic studies of Carex.
format Online
Article
Text
id pubmed-8510598
institution National Center for Biotechnology Information
language English
publishDate 2021
publisher Taylor & Francis
record_format MEDLINE/PubMed
spelling pubmed-85105982021-10-13 The complete chloroplast genome of Carex agglomerata C. B. Clarke (Cyperaceae), an endemic species from China Xun, Lu-Lu Ding, Fang-Bin Chen, Chen Liu, Pei-Liang Lu, Yuan Zhou, Ya-Fu Zhang, Ya-Wei Li, Si-Feng Mitochondrial DNA B Resour Mitogenome Announcement Carex agglomerata C. B. Clarke is a sedge with excellent ornamental characters, it is an important ecosystem stabilizer. Here we report the complete chloroplast genome of C. agglomerata to provide a foundation for further phylogenetic studies on the Cyperaceae. The chloroplast (cp) genome is 184,157 bp in size and consists of a large single-copy (LSC) region 106,654 bp in length, a small single-copy (SSC) region of 36,099 bp, two inverted repeats (IR) regions each 20,702 bp. The total GC content of the cp genome is 33.9% with the LSC, SSC, and IR regions 32, 32.5, and 42.9%, respectively. The cp genome contains 128 genes, including 80 protein-coding, 40 tRNA, and eight rRNA genes. The phylogenetic analysis showed C. agglomerata is in a clade with Carex neurocarpa Maxim and Carex siderosticta Hance. This study provides a basis for further phylogenetic studies of Carex. Taylor & Francis 2021-10-05 /pmc/articles/PMC8510598/ /pubmed/34651074 http://dx.doi.org/10.1080/23802359.2021.1984326 Text en © 2021 The Author(s). Published by Informa UK Limited, trading as Taylor & Francis Group. https://creativecommons.org/licenses/by/4.0/This is an Open Access article distributed under the terms of the Creative Commons Attribution License (http://creativecommons.org/licenses/by/4.0/ (https://creativecommons.org/licenses/by/4.0/) ), which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited.
spellingShingle Mitogenome Announcement
Xun, Lu-Lu
Ding, Fang-Bin
Chen, Chen
Liu, Pei-Liang
Lu, Yuan
Zhou, Ya-Fu
Zhang, Ya-Wei
Li, Si-Feng
The complete chloroplast genome of Carex agglomerata C. B. Clarke (Cyperaceae), an endemic species from China
title The complete chloroplast genome of Carex agglomerata C. B. Clarke (Cyperaceae), an endemic species from China
title_full The complete chloroplast genome of Carex agglomerata C. B. Clarke (Cyperaceae), an endemic species from China
title_fullStr The complete chloroplast genome of Carex agglomerata C. B. Clarke (Cyperaceae), an endemic species from China
title_full_unstemmed The complete chloroplast genome of Carex agglomerata C. B. Clarke (Cyperaceae), an endemic species from China
title_short The complete chloroplast genome of Carex agglomerata C. B. Clarke (Cyperaceae), an endemic species from China
title_sort complete chloroplast genome of carex agglomerata c. b. clarke (cyperaceae), an endemic species from china
topic Mitogenome Announcement
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8510598/
https://www.ncbi.nlm.nih.gov/pubmed/34651074
http://dx.doi.org/10.1080/23802359.2021.1984326
work_keys_str_mv AT xunlulu thecompletechloroplastgenomeofcarexagglomeratacbclarkecyperaceaeanendemicspeciesfromchina
AT dingfangbin thecompletechloroplastgenomeofcarexagglomeratacbclarkecyperaceaeanendemicspeciesfromchina
AT chenchen thecompletechloroplastgenomeofcarexagglomeratacbclarkecyperaceaeanendemicspeciesfromchina
AT liupeiliang thecompletechloroplastgenomeofcarexagglomeratacbclarkecyperaceaeanendemicspeciesfromchina
AT luyuan thecompletechloroplastgenomeofcarexagglomeratacbclarkecyperaceaeanendemicspeciesfromchina
AT zhouyafu thecompletechloroplastgenomeofcarexagglomeratacbclarkecyperaceaeanendemicspeciesfromchina
AT zhangyawei thecompletechloroplastgenomeofcarexagglomeratacbclarkecyperaceaeanendemicspeciesfromchina
AT lisifeng thecompletechloroplastgenomeofcarexagglomeratacbclarkecyperaceaeanendemicspeciesfromchina
AT xunlulu completechloroplastgenomeofcarexagglomeratacbclarkecyperaceaeanendemicspeciesfromchina
AT dingfangbin completechloroplastgenomeofcarexagglomeratacbclarkecyperaceaeanendemicspeciesfromchina
AT chenchen completechloroplastgenomeofcarexagglomeratacbclarkecyperaceaeanendemicspeciesfromchina
AT liupeiliang completechloroplastgenomeofcarexagglomeratacbclarkecyperaceaeanendemicspeciesfromchina
AT luyuan completechloroplastgenomeofcarexagglomeratacbclarkecyperaceaeanendemicspeciesfromchina
AT zhouyafu completechloroplastgenomeofcarexagglomeratacbclarkecyperaceaeanendemicspeciesfromchina
AT zhangyawei completechloroplastgenomeofcarexagglomeratacbclarkecyperaceaeanendemicspeciesfromchina
AT lisifeng completechloroplastgenomeofcarexagglomeratacbclarkecyperaceaeanendemicspeciesfromchina