Cargando…
The complete chloroplast genome of Carex agglomerata C. B. Clarke (Cyperaceae), an endemic species from China
Carex agglomerata C. B. Clarke is a sedge with excellent ornamental characters, it is an important ecosystem stabilizer. Here we report the complete chloroplast genome of C. agglomerata to provide a foundation for further phylogenetic studies on the Cyperaceae. The chloroplast (cp) genome is 184,157...
Autores principales: | , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Taylor & Francis
2021
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8510598/ https://www.ncbi.nlm.nih.gov/pubmed/34651074 http://dx.doi.org/10.1080/23802359.2021.1984326 |
_version_ | 1784582608679600128 |
---|---|
author | Xun, Lu-Lu Ding, Fang-Bin Chen, Chen Liu, Pei-Liang Lu, Yuan Zhou, Ya-Fu Zhang, Ya-Wei Li, Si-Feng |
author_facet | Xun, Lu-Lu Ding, Fang-Bin Chen, Chen Liu, Pei-Liang Lu, Yuan Zhou, Ya-Fu Zhang, Ya-Wei Li, Si-Feng |
author_sort | Xun, Lu-Lu |
collection | PubMed |
description | Carex agglomerata C. B. Clarke is a sedge with excellent ornamental characters, it is an important ecosystem stabilizer. Here we report the complete chloroplast genome of C. agglomerata to provide a foundation for further phylogenetic studies on the Cyperaceae. The chloroplast (cp) genome is 184,157 bp in size and consists of a large single-copy (LSC) region 106,654 bp in length, a small single-copy (SSC) region of 36,099 bp, two inverted repeats (IR) regions each 20,702 bp. The total GC content of the cp genome is 33.9% with the LSC, SSC, and IR regions 32, 32.5, and 42.9%, respectively. The cp genome contains 128 genes, including 80 protein-coding, 40 tRNA, and eight rRNA genes. The phylogenetic analysis showed C. agglomerata is in a clade with Carex neurocarpa Maxim and Carex siderosticta Hance. This study provides a basis for further phylogenetic studies of Carex. |
format | Online Article Text |
id | pubmed-8510598 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2021 |
publisher | Taylor & Francis |
record_format | MEDLINE/PubMed |
spelling | pubmed-85105982021-10-13 The complete chloroplast genome of Carex agglomerata C. B. Clarke (Cyperaceae), an endemic species from China Xun, Lu-Lu Ding, Fang-Bin Chen, Chen Liu, Pei-Liang Lu, Yuan Zhou, Ya-Fu Zhang, Ya-Wei Li, Si-Feng Mitochondrial DNA B Resour Mitogenome Announcement Carex agglomerata C. B. Clarke is a sedge with excellent ornamental characters, it is an important ecosystem stabilizer. Here we report the complete chloroplast genome of C. agglomerata to provide a foundation for further phylogenetic studies on the Cyperaceae. The chloroplast (cp) genome is 184,157 bp in size and consists of a large single-copy (LSC) region 106,654 bp in length, a small single-copy (SSC) region of 36,099 bp, two inverted repeats (IR) regions each 20,702 bp. The total GC content of the cp genome is 33.9% with the LSC, SSC, and IR regions 32, 32.5, and 42.9%, respectively. The cp genome contains 128 genes, including 80 protein-coding, 40 tRNA, and eight rRNA genes. The phylogenetic analysis showed C. agglomerata is in a clade with Carex neurocarpa Maxim and Carex siderosticta Hance. This study provides a basis for further phylogenetic studies of Carex. Taylor & Francis 2021-10-05 /pmc/articles/PMC8510598/ /pubmed/34651074 http://dx.doi.org/10.1080/23802359.2021.1984326 Text en © 2021 The Author(s). Published by Informa UK Limited, trading as Taylor & Francis Group. https://creativecommons.org/licenses/by/4.0/This is an Open Access article distributed under the terms of the Creative Commons Attribution License (http://creativecommons.org/licenses/by/4.0/ (https://creativecommons.org/licenses/by/4.0/) ), which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited. |
spellingShingle | Mitogenome Announcement Xun, Lu-Lu Ding, Fang-Bin Chen, Chen Liu, Pei-Liang Lu, Yuan Zhou, Ya-Fu Zhang, Ya-Wei Li, Si-Feng The complete chloroplast genome of Carex agglomerata C. B. Clarke (Cyperaceae), an endemic species from China |
title | The complete chloroplast genome of Carex agglomerata C. B. Clarke (Cyperaceae), an endemic species from China |
title_full | The complete chloroplast genome of Carex agglomerata C. B. Clarke (Cyperaceae), an endemic species from China |
title_fullStr | The complete chloroplast genome of Carex agglomerata C. B. Clarke (Cyperaceae), an endemic species from China |
title_full_unstemmed | The complete chloroplast genome of Carex agglomerata C. B. Clarke (Cyperaceae), an endemic species from China |
title_short | The complete chloroplast genome of Carex agglomerata C. B. Clarke (Cyperaceae), an endemic species from China |
title_sort | complete chloroplast genome of carex agglomerata c. b. clarke (cyperaceae), an endemic species from china |
topic | Mitogenome Announcement |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8510598/ https://www.ncbi.nlm.nih.gov/pubmed/34651074 http://dx.doi.org/10.1080/23802359.2021.1984326 |
work_keys_str_mv | AT xunlulu thecompletechloroplastgenomeofcarexagglomeratacbclarkecyperaceaeanendemicspeciesfromchina AT dingfangbin thecompletechloroplastgenomeofcarexagglomeratacbclarkecyperaceaeanendemicspeciesfromchina AT chenchen thecompletechloroplastgenomeofcarexagglomeratacbclarkecyperaceaeanendemicspeciesfromchina AT liupeiliang thecompletechloroplastgenomeofcarexagglomeratacbclarkecyperaceaeanendemicspeciesfromchina AT luyuan thecompletechloroplastgenomeofcarexagglomeratacbclarkecyperaceaeanendemicspeciesfromchina AT zhouyafu thecompletechloroplastgenomeofcarexagglomeratacbclarkecyperaceaeanendemicspeciesfromchina AT zhangyawei thecompletechloroplastgenomeofcarexagglomeratacbclarkecyperaceaeanendemicspeciesfromchina AT lisifeng thecompletechloroplastgenomeofcarexagglomeratacbclarkecyperaceaeanendemicspeciesfromchina AT xunlulu completechloroplastgenomeofcarexagglomeratacbclarkecyperaceaeanendemicspeciesfromchina AT dingfangbin completechloroplastgenomeofcarexagglomeratacbclarkecyperaceaeanendemicspeciesfromchina AT chenchen completechloroplastgenomeofcarexagglomeratacbclarkecyperaceaeanendemicspeciesfromchina AT liupeiliang completechloroplastgenomeofcarexagglomeratacbclarkecyperaceaeanendemicspeciesfromchina AT luyuan completechloroplastgenomeofcarexagglomeratacbclarkecyperaceaeanendemicspeciesfromchina AT zhouyafu completechloroplastgenomeofcarexagglomeratacbclarkecyperaceaeanendemicspeciesfromchina AT zhangyawei completechloroplastgenomeofcarexagglomeratacbclarkecyperaceaeanendemicspeciesfromchina AT lisifeng completechloroplastgenomeofcarexagglomeratacbclarkecyperaceaeanendemicspeciesfromchina |