Cargando…

Occurrence and molecular characterization of Cryptosporidium spp., Giardia duodenalis, Enterocytozoon bieneusi, and Blastocystis sp. in captive wild animals in zoos in Henan, China

BACKGROUND: Captive wild animals in zoos infected with Cryptosporidium spp., Giardia duodenalis, Enterocytozoon bieneusi, and Blastocystis sp. can be sources of zoonotic infections and diseases. Therefore, to investigate the distribution of these pathogens in captive wild animals of zoos in Henan, C...

Descripción completa

Detalles Bibliográficos
Autores principales: Zhang, Kaihui, Zheng, Shuangjian, Wang, Yilin, Wang, Ke, Wang, Yuexin, Gazizova, Azhar, Han, Kelei, Yu, Fuchang, Chen, Yuancai, Zhang, Longxian
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2021
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8522229/
https://www.ncbi.nlm.nih.gov/pubmed/34663327
http://dx.doi.org/10.1186/s12917-021-03035-0
_version_ 1784585050327613440
author Zhang, Kaihui
Zheng, Shuangjian
Wang, Yilin
Wang, Ke
Wang, Yuexin
Gazizova, Azhar
Han, Kelei
Yu, Fuchang
Chen, Yuancai
Zhang, Longxian
author_facet Zhang, Kaihui
Zheng, Shuangjian
Wang, Yilin
Wang, Ke
Wang, Yuexin
Gazizova, Azhar
Han, Kelei
Yu, Fuchang
Chen, Yuancai
Zhang, Longxian
author_sort Zhang, Kaihui
collection PubMed
description BACKGROUND: Captive wild animals in zoos infected with Cryptosporidium spp., Giardia duodenalis, Enterocytozoon bieneusi, and Blastocystis sp. can be sources of zoonotic infections and diseases. Therefore, to investigate the distribution of these pathogens in captive wild animals of zoos in Henan, China, a total of 429 fresh fecal samples were collected from six zoos in Henan, China. The infection rates of Cryptosporidium spp., G. duodenalis, E. bieneusi, and Blastocystis sp. were determined by PCR analysis of corresponding loci. Positive results for Cryptosporidium (C. parvum and C. hominis) were subtyped based on the (gp60) gene. RESULTS: The overall prevalence was 43.1% (185/429), and the prevalence of Cryptosporidium, Giardia duodenalis, Enterocytozoon bieneusi, and Blastocystis sp. were 2.8% (12/429), 0.5% (2/429), 20.8% (89/429), and 19.1% (82/429), respectively. Five Cryptosporidium species, namely, C. hominis, C. parvum, C. muris, C. andersoni, and C. macropodum, were identified in this study. Cryptosporidium parvum was further subtyped as IIdA19G1. Two Giardia duodenalis assemblages (A and E) were also identified. A total of 20 Enterocytozoon bieneusi genotypes were detected, including 18 known (BEB6, D, HND-1, CD7, SDD1, Henan-IV, KIN-1, CHK1, Peru8, Henan-V, CHG11, CHG-1, CHS9, CHG21, Type-IV, CHC9, CM5, and CHB1) and 2 novel genotypes (CHWD1 and CHPM1). A total of nine subtypes of Blastocystis sp. (ST1, ST2, ST3, ST5, ST6, ST7, ST10, ST13, and ST14) were identified in captive wild animals in zoos in the present study. Cryptosporidium andersoni, nine Enterocytozoon bieneusi genotypes, and five Blastocystis subtypes were here first identified in new hosts. CONCLUSIONS: Our study has expanded the host ranges of these four pathogens. The data indicate that animals in zoos can commonly be infected with these four zoonotic pathogens, and animals in zoos are potential sources of zoonotic infections in humans. SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1186/s12917-021-03035-0.
format Online
Article
Text
id pubmed-8522229
institution National Center for Biotechnology Information
language English
publishDate 2021
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-85222292021-10-21 Occurrence and molecular characterization of Cryptosporidium spp., Giardia duodenalis, Enterocytozoon bieneusi, and Blastocystis sp. in captive wild animals in zoos in Henan, China Zhang, Kaihui Zheng, Shuangjian Wang, Yilin Wang, Ke Wang, Yuexin Gazizova, Azhar Han, Kelei Yu, Fuchang Chen, Yuancai Zhang, Longxian BMC Vet Res Research Article BACKGROUND: Captive wild animals in zoos infected with Cryptosporidium spp., Giardia duodenalis, Enterocytozoon bieneusi, and Blastocystis sp. can be sources of zoonotic infections and diseases. Therefore, to investigate the distribution of these pathogens in captive wild animals of zoos in Henan, China, a total of 429 fresh fecal samples were collected from six zoos in Henan, China. The infection rates of Cryptosporidium spp., G. duodenalis, E. bieneusi, and Blastocystis sp. were determined by PCR analysis of corresponding loci. Positive results for Cryptosporidium (C. parvum and C. hominis) were subtyped based on the (gp60) gene. RESULTS: The overall prevalence was 43.1% (185/429), and the prevalence of Cryptosporidium, Giardia duodenalis, Enterocytozoon bieneusi, and Blastocystis sp. were 2.8% (12/429), 0.5% (2/429), 20.8% (89/429), and 19.1% (82/429), respectively. Five Cryptosporidium species, namely, C. hominis, C. parvum, C. muris, C. andersoni, and C. macropodum, were identified in this study. Cryptosporidium parvum was further subtyped as IIdA19G1. Two Giardia duodenalis assemblages (A and E) were also identified. A total of 20 Enterocytozoon bieneusi genotypes were detected, including 18 known (BEB6, D, HND-1, CD7, SDD1, Henan-IV, KIN-1, CHK1, Peru8, Henan-V, CHG11, CHG-1, CHS9, CHG21, Type-IV, CHC9, CM5, and CHB1) and 2 novel genotypes (CHWD1 and CHPM1). A total of nine subtypes of Blastocystis sp. (ST1, ST2, ST3, ST5, ST6, ST7, ST10, ST13, and ST14) were identified in captive wild animals in zoos in the present study. Cryptosporidium andersoni, nine Enterocytozoon bieneusi genotypes, and five Blastocystis subtypes were here first identified in new hosts. CONCLUSIONS: Our study has expanded the host ranges of these four pathogens. The data indicate that animals in zoos can commonly be infected with these four zoonotic pathogens, and animals in zoos are potential sources of zoonotic infections in humans. SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1186/s12917-021-03035-0. BioMed Central 2021-10-18 /pmc/articles/PMC8522229/ /pubmed/34663327 http://dx.doi.org/10.1186/s12917-021-03035-0 Text en © The Author(s) 2021 https://creativecommons.org/licenses/by/4.0/Open AccessThis article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/ (https://creativecommons.org/licenses/by/4.0/) . The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/ (https://creativecommons.org/publicdomain/zero/1.0/) ) applies to the data made available in this article, unless otherwise stated in a credit line to the data.
spellingShingle Research Article
Zhang, Kaihui
Zheng, Shuangjian
Wang, Yilin
Wang, Ke
Wang, Yuexin
Gazizova, Azhar
Han, Kelei
Yu, Fuchang
Chen, Yuancai
Zhang, Longxian
Occurrence and molecular characterization of Cryptosporidium spp., Giardia duodenalis, Enterocytozoon bieneusi, and Blastocystis sp. in captive wild animals in zoos in Henan, China
title Occurrence and molecular characterization of Cryptosporidium spp., Giardia duodenalis, Enterocytozoon bieneusi, and Blastocystis sp. in captive wild animals in zoos in Henan, China
title_full Occurrence and molecular characterization of Cryptosporidium spp., Giardia duodenalis, Enterocytozoon bieneusi, and Blastocystis sp. in captive wild animals in zoos in Henan, China
title_fullStr Occurrence and molecular characterization of Cryptosporidium spp., Giardia duodenalis, Enterocytozoon bieneusi, and Blastocystis sp. in captive wild animals in zoos in Henan, China
title_full_unstemmed Occurrence and molecular characterization of Cryptosporidium spp., Giardia duodenalis, Enterocytozoon bieneusi, and Blastocystis sp. in captive wild animals in zoos in Henan, China
title_short Occurrence and molecular characterization of Cryptosporidium spp., Giardia duodenalis, Enterocytozoon bieneusi, and Blastocystis sp. in captive wild animals in zoos in Henan, China
title_sort occurrence and molecular characterization of cryptosporidium spp., giardia duodenalis, enterocytozoon bieneusi, and blastocystis sp. in captive wild animals in zoos in henan, china
topic Research Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8522229/
https://www.ncbi.nlm.nih.gov/pubmed/34663327
http://dx.doi.org/10.1186/s12917-021-03035-0
work_keys_str_mv AT zhangkaihui occurrenceandmolecularcharacterizationofcryptosporidiumsppgiardiaduodenalisenterocytozoonbieneusiandblastocystisspincaptivewildanimalsinzoosinhenanchina
AT zhengshuangjian occurrenceandmolecularcharacterizationofcryptosporidiumsppgiardiaduodenalisenterocytozoonbieneusiandblastocystisspincaptivewildanimalsinzoosinhenanchina
AT wangyilin occurrenceandmolecularcharacterizationofcryptosporidiumsppgiardiaduodenalisenterocytozoonbieneusiandblastocystisspincaptivewildanimalsinzoosinhenanchina
AT wangke occurrenceandmolecularcharacterizationofcryptosporidiumsppgiardiaduodenalisenterocytozoonbieneusiandblastocystisspincaptivewildanimalsinzoosinhenanchina
AT wangyuexin occurrenceandmolecularcharacterizationofcryptosporidiumsppgiardiaduodenalisenterocytozoonbieneusiandblastocystisspincaptivewildanimalsinzoosinhenanchina
AT gazizovaazhar occurrenceandmolecularcharacterizationofcryptosporidiumsppgiardiaduodenalisenterocytozoonbieneusiandblastocystisspincaptivewildanimalsinzoosinhenanchina
AT hankelei occurrenceandmolecularcharacterizationofcryptosporidiumsppgiardiaduodenalisenterocytozoonbieneusiandblastocystisspincaptivewildanimalsinzoosinhenanchina
AT yufuchang occurrenceandmolecularcharacterizationofcryptosporidiumsppgiardiaduodenalisenterocytozoonbieneusiandblastocystisspincaptivewildanimalsinzoosinhenanchina
AT chenyuancai occurrenceandmolecularcharacterizationofcryptosporidiumsppgiardiaduodenalisenterocytozoonbieneusiandblastocystisspincaptivewildanimalsinzoosinhenanchina
AT zhanglongxian occurrenceandmolecularcharacterizationofcryptosporidiumsppgiardiaduodenalisenterocytozoonbieneusiandblastocystisspincaptivewildanimalsinzoosinhenanchina