Cargando…
Automatic barcode gap discovery reveals diverse clades of Rhipicephalus spp. and Haemaphysalis spp. ticks from small mammals in 'Asir, Saudi Arabia
BACKGROUND: The ixodid tick genera Rhipicephalus and Haemaphysalis contain several species of medical and/or veterinary importance, but their diversity in some regions of the world remains under-explored. For instance, very few modern studies have been performed on the taxonomy of these genera on th...
Autores principales: | , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2021
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8527726/ https://www.ncbi.nlm.nih.gov/pubmed/34666829 http://dx.doi.org/10.1186/s13071-021-05049-x |
_version_ | 1784586127994257408 |
---|---|
author | Alghamdi, Samia Q. Low, Van Lun Alkathiry, Hadil A. Alagaili, Abdulaziz N. McGarry, John W. Makepeace, Benjamin L. |
author_facet | Alghamdi, Samia Q. Low, Van Lun Alkathiry, Hadil A. Alagaili, Abdulaziz N. McGarry, John W. Makepeace, Benjamin L. |
author_sort | Alghamdi, Samia Q. |
collection | PubMed |
description | BACKGROUND: The ixodid tick genera Rhipicephalus and Haemaphysalis contain several species of medical and/or veterinary importance, but their diversity in some regions of the world remains under-explored. For instance, very few modern studies have been performed on the taxonomy of these genera on the Arabian Peninsula. METHODS: In this study, we trapped small mammals in the 'Asir Mountains of south-western Saudi Arabia and collected tick specimens for morphological examination and molecular barcoding, targeting three mitochondrial loci: cox1, 16S rRNA and 12S rRNA. RESULTS: We obtained a total of 733 ticks (608 Haemaphysalis spp. and 125 Rhipicephalus spp.) from 75 small mammal hosts belonging to six species. All tick specimens were immature except for nine adults recovered from a hedgehog (Paraechinus aethiopicus). Morphologically, the Rhipicephalus ticks resembled R. camicasi, but the Haemaphysalis ticks showed differences in palp morphology compared with species previously described from Saudi Arabia. Phylogenetic analysis and automatic barcode gap discovery identified a novel clade of Rhipicephalus sp. representing most of the nymphs. This was most closely related to R. leporis, R. guilhoni and R. linnaei. The adult ticks and a small proportion of nymphs clustered with R. camicasi sequences from a previous study. Finally, the Haemaphysalis nymphs formed two distinct clades that were clearly separated from all reference sequences but closest to some African species. CONCLUSIONS: This apparent high level of tick diversity observed in a single study site of only ~ 170 km(2), on a relatively small number of hosts, highlights the potential for the discovery of new tick species on the Arabian Peninsula. GRAPHICAL ABSTRACT: [Image: see text] SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1186/s13071-021-05049-x. |
format | Online Article Text |
id | pubmed-8527726 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2021 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-85277262021-10-25 Automatic barcode gap discovery reveals diverse clades of Rhipicephalus spp. and Haemaphysalis spp. ticks from small mammals in 'Asir, Saudi Arabia Alghamdi, Samia Q. Low, Van Lun Alkathiry, Hadil A. Alagaili, Abdulaziz N. McGarry, John W. Makepeace, Benjamin L. Parasit Vectors Research BACKGROUND: The ixodid tick genera Rhipicephalus and Haemaphysalis contain several species of medical and/or veterinary importance, but their diversity in some regions of the world remains under-explored. For instance, very few modern studies have been performed on the taxonomy of these genera on the Arabian Peninsula. METHODS: In this study, we trapped small mammals in the 'Asir Mountains of south-western Saudi Arabia and collected tick specimens for morphological examination and molecular barcoding, targeting three mitochondrial loci: cox1, 16S rRNA and 12S rRNA. RESULTS: We obtained a total of 733 ticks (608 Haemaphysalis spp. and 125 Rhipicephalus spp.) from 75 small mammal hosts belonging to six species. All tick specimens were immature except for nine adults recovered from a hedgehog (Paraechinus aethiopicus). Morphologically, the Rhipicephalus ticks resembled R. camicasi, but the Haemaphysalis ticks showed differences in palp morphology compared with species previously described from Saudi Arabia. Phylogenetic analysis and automatic barcode gap discovery identified a novel clade of Rhipicephalus sp. representing most of the nymphs. This was most closely related to R. leporis, R. guilhoni and R. linnaei. The adult ticks and a small proportion of nymphs clustered with R. camicasi sequences from a previous study. Finally, the Haemaphysalis nymphs formed two distinct clades that were clearly separated from all reference sequences but closest to some African species. CONCLUSIONS: This apparent high level of tick diversity observed in a single study site of only ~ 170 km(2), on a relatively small number of hosts, highlights the potential for the discovery of new tick species on the Arabian Peninsula. GRAPHICAL ABSTRACT: [Image: see text] SUPPLEMENTARY INFORMATION: The online version contains supplementary material available at 10.1186/s13071-021-05049-x. BioMed Central 2021-10-19 /pmc/articles/PMC8527726/ /pubmed/34666829 http://dx.doi.org/10.1186/s13071-021-05049-x Text en © The Author(s) 2021 https://creativecommons.org/licenses/by/4.0/Open AccessThis article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/ (https://creativecommons.org/licenses/by/4.0/) . The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/ (https://creativecommons.org/publicdomain/zero/1.0/) ) applies to the data made available in this article, unless otherwise stated in a credit line to the data. |
spellingShingle | Research Alghamdi, Samia Q. Low, Van Lun Alkathiry, Hadil A. Alagaili, Abdulaziz N. McGarry, John W. Makepeace, Benjamin L. Automatic barcode gap discovery reveals diverse clades of Rhipicephalus spp. and Haemaphysalis spp. ticks from small mammals in 'Asir, Saudi Arabia |
title | Automatic barcode gap discovery reveals diverse clades of Rhipicephalus spp. and Haemaphysalis spp. ticks from small mammals in 'Asir, Saudi Arabia |
title_full | Automatic barcode gap discovery reveals diverse clades of Rhipicephalus spp. and Haemaphysalis spp. ticks from small mammals in 'Asir, Saudi Arabia |
title_fullStr | Automatic barcode gap discovery reveals diverse clades of Rhipicephalus spp. and Haemaphysalis spp. ticks from small mammals in 'Asir, Saudi Arabia |
title_full_unstemmed | Automatic barcode gap discovery reveals diverse clades of Rhipicephalus spp. and Haemaphysalis spp. ticks from small mammals in 'Asir, Saudi Arabia |
title_short | Automatic barcode gap discovery reveals diverse clades of Rhipicephalus spp. and Haemaphysalis spp. ticks from small mammals in 'Asir, Saudi Arabia |
title_sort | automatic barcode gap discovery reveals diverse clades of rhipicephalus spp. and haemaphysalis spp. ticks from small mammals in 'asir, saudi arabia |
topic | Research |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8527726/ https://www.ncbi.nlm.nih.gov/pubmed/34666829 http://dx.doi.org/10.1186/s13071-021-05049-x |
work_keys_str_mv | AT alghamdisamiaq automaticbarcodegapdiscoveryrevealsdiversecladesofrhipicephalussppandhaemaphysalissppticksfromsmallmammalsinasirsaudiarabia AT lowvanlun automaticbarcodegapdiscoveryrevealsdiversecladesofrhipicephalussppandhaemaphysalissppticksfromsmallmammalsinasirsaudiarabia AT alkathiryhadila automaticbarcodegapdiscoveryrevealsdiversecladesofrhipicephalussppandhaemaphysalissppticksfromsmallmammalsinasirsaudiarabia AT alagailiabdulazizn automaticbarcodegapdiscoveryrevealsdiversecladesofrhipicephalussppandhaemaphysalissppticksfromsmallmammalsinasirsaudiarabia AT mcgarryjohnw automaticbarcodegapdiscoveryrevealsdiversecladesofrhipicephalussppandhaemaphysalissppticksfromsmallmammalsinasirsaudiarabia AT makepeacebenjaminl automaticbarcodegapdiscoveryrevealsdiversecladesofrhipicephalussppandhaemaphysalissppticksfromsmallmammalsinasirsaudiarabia |