Cargando…
The Frequency of DNA Mismatch Repair Deficiency Is Very Low in Surgically Resected Lung Carcinoma
INTRODUCTION: DNA mismatch repair (MMR) deficiency leads to changes in the length of nucleotide repeat sequences of tumor DNA. In that situation, DNA replicational errors occur and accumulate during DNA replication. As a result, this mechanism frequently affects the coding regions of oncogenes and t...
Autores principales: | , , , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Frontiers Media S.A.
2021
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8527876/ https://www.ncbi.nlm.nih.gov/pubmed/34692533 http://dx.doi.org/10.3389/fonc.2021.752005 |
_version_ | 1784586155905253376 |
---|---|
author | Yanagawa, Naoki Yamada, Noriyuki Sugimoto, Ryo Osakabe, Mitsumasa Uesugi, Noriyuki Shiono, Satoshi Endoh, Makoto Ogata, Shin-ya Saito, Hajime Maemondo, Makoto Sugai, Tamotsu |
author_facet | Yanagawa, Naoki Yamada, Noriyuki Sugimoto, Ryo Osakabe, Mitsumasa Uesugi, Noriyuki Shiono, Satoshi Endoh, Makoto Ogata, Shin-ya Saito, Hajime Maemondo, Makoto Sugai, Tamotsu |
author_sort | Yanagawa, Naoki |
collection | PubMed |
description | INTRODUCTION: DNA mismatch repair (MMR) deficiency leads to changes in the length of nucleotide repeat sequences of tumor DNA. In that situation, DNA replicational errors occur and accumulate during DNA replication. As a result, this mechanism frequently affects the coding regions of oncogenes and tumor suppressor genes and causes carcinogenesis. Recently, DNA MMR deficiency has been recognized as a predictive biomarker for immunotherapy. The aim of this study is to examine the frequency of DNA MMR deficiency and clinicopathological characteristics in surgically resected lung carcinoma (LC) and their correlation. METHODS: A total of 1153 LCs were examined. Tissue microarrays were constructed. The status of MMR deficiency was evaluated by immunohistochemical analysis of MMR protein expression (hMLH1, hMSH2, hMSH6, and hPMS2). Microsatellite instability analysis, BRAF mutation, and MLH1 methylation analysis were performed for cases that showed MMR deficiency. RESULTS: Only 2 of the 1153 cases (0.17%) showed a loss of hMLH1/hPMS2 protein expression. They also had high levels of microsatellite instability (MSI-H), had neither MLH1 promoter methylation nor BRAF mutation, and were male smokers. Histopathologically, one was a squamous cell carcinoma, and the other was combined small cell carcinoma with squamous cell carcinoma. Regarding PD-L1 protein expression, one had high expression, and the other had none. CONCLUSION: The frequency of MMR deficiency was very low in LC. However, our two cases were non-adenocarcinoma and differed from previous studies. Because of its very low frequency, MMR deficiency is not a practical biomarker to predict the effect of immune checkpoint inhibitors in LC. |
format | Online Article Text |
id | pubmed-8527876 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2021 |
publisher | Frontiers Media S.A. |
record_format | MEDLINE/PubMed |
spelling | pubmed-85278762021-10-21 The Frequency of DNA Mismatch Repair Deficiency Is Very Low in Surgically Resected Lung Carcinoma Yanagawa, Naoki Yamada, Noriyuki Sugimoto, Ryo Osakabe, Mitsumasa Uesugi, Noriyuki Shiono, Satoshi Endoh, Makoto Ogata, Shin-ya Saito, Hajime Maemondo, Makoto Sugai, Tamotsu Front Oncol Oncology INTRODUCTION: DNA mismatch repair (MMR) deficiency leads to changes in the length of nucleotide repeat sequences of tumor DNA. In that situation, DNA replicational errors occur and accumulate during DNA replication. As a result, this mechanism frequently affects the coding regions of oncogenes and tumor suppressor genes and causes carcinogenesis. Recently, DNA MMR deficiency has been recognized as a predictive biomarker for immunotherapy. The aim of this study is to examine the frequency of DNA MMR deficiency and clinicopathological characteristics in surgically resected lung carcinoma (LC) and their correlation. METHODS: A total of 1153 LCs were examined. Tissue microarrays were constructed. The status of MMR deficiency was evaluated by immunohistochemical analysis of MMR protein expression (hMLH1, hMSH2, hMSH6, and hPMS2). Microsatellite instability analysis, BRAF mutation, and MLH1 methylation analysis were performed for cases that showed MMR deficiency. RESULTS: Only 2 of the 1153 cases (0.17%) showed a loss of hMLH1/hPMS2 protein expression. They also had high levels of microsatellite instability (MSI-H), had neither MLH1 promoter methylation nor BRAF mutation, and were male smokers. Histopathologically, one was a squamous cell carcinoma, and the other was combined small cell carcinoma with squamous cell carcinoma. Regarding PD-L1 protein expression, one had high expression, and the other had none. CONCLUSION: The frequency of MMR deficiency was very low in LC. However, our two cases were non-adenocarcinoma and differed from previous studies. Because of its very low frequency, MMR deficiency is not a practical biomarker to predict the effect of immune checkpoint inhibitors in LC. Frontiers Media S.A. 2021-10-06 /pmc/articles/PMC8527876/ /pubmed/34692533 http://dx.doi.org/10.3389/fonc.2021.752005 Text en Copyright © 2021 Yanagawa, Yamada, Sugimoto, Osakabe, Uesugi, Shiono, Endoh, Ogata, Saito, Maemondo and Sugai https://creativecommons.org/licenses/by/4.0/This is an open-access article distributed under the terms of the Creative Commons Attribution License (CC BY). The use, distribution or reproduction in other forums is permitted, provided the original author(s) and the copyright owner(s) are credited and that the original publication in this journal is cited, in accordance with accepted academic practice. No use, distribution or reproduction is permitted which does not comply with these terms. |
spellingShingle | Oncology Yanagawa, Naoki Yamada, Noriyuki Sugimoto, Ryo Osakabe, Mitsumasa Uesugi, Noriyuki Shiono, Satoshi Endoh, Makoto Ogata, Shin-ya Saito, Hajime Maemondo, Makoto Sugai, Tamotsu The Frequency of DNA Mismatch Repair Deficiency Is Very Low in Surgically Resected Lung Carcinoma |
title | The Frequency of DNA Mismatch Repair Deficiency Is Very Low in Surgically Resected Lung Carcinoma |
title_full | The Frequency of DNA Mismatch Repair Deficiency Is Very Low in Surgically Resected Lung Carcinoma |
title_fullStr | The Frequency of DNA Mismatch Repair Deficiency Is Very Low in Surgically Resected Lung Carcinoma |
title_full_unstemmed | The Frequency of DNA Mismatch Repair Deficiency Is Very Low in Surgically Resected Lung Carcinoma |
title_short | The Frequency of DNA Mismatch Repair Deficiency Is Very Low in Surgically Resected Lung Carcinoma |
title_sort | frequency of dna mismatch repair deficiency is very low in surgically resected lung carcinoma |
topic | Oncology |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8527876/ https://www.ncbi.nlm.nih.gov/pubmed/34692533 http://dx.doi.org/10.3389/fonc.2021.752005 |
work_keys_str_mv | AT yanagawanaoki thefrequencyofdnamismatchrepairdeficiencyisverylowinsurgicallyresectedlungcarcinoma AT yamadanoriyuki thefrequencyofdnamismatchrepairdeficiencyisverylowinsurgicallyresectedlungcarcinoma AT sugimotoryo thefrequencyofdnamismatchrepairdeficiencyisverylowinsurgicallyresectedlungcarcinoma AT osakabemitsumasa thefrequencyofdnamismatchrepairdeficiencyisverylowinsurgicallyresectedlungcarcinoma AT uesuginoriyuki thefrequencyofdnamismatchrepairdeficiencyisverylowinsurgicallyresectedlungcarcinoma AT shionosatoshi thefrequencyofdnamismatchrepairdeficiencyisverylowinsurgicallyresectedlungcarcinoma AT endohmakoto thefrequencyofdnamismatchrepairdeficiencyisverylowinsurgicallyresectedlungcarcinoma AT ogatashinya thefrequencyofdnamismatchrepairdeficiencyisverylowinsurgicallyresectedlungcarcinoma AT saitohajime thefrequencyofdnamismatchrepairdeficiencyisverylowinsurgicallyresectedlungcarcinoma AT maemondomakoto thefrequencyofdnamismatchrepairdeficiencyisverylowinsurgicallyresectedlungcarcinoma AT sugaitamotsu thefrequencyofdnamismatchrepairdeficiencyisverylowinsurgicallyresectedlungcarcinoma AT yanagawanaoki frequencyofdnamismatchrepairdeficiencyisverylowinsurgicallyresectedlungcarcinoma AT yamadanoriyuki frequencyofdnamismatchrepairdeficiencyisverylowinsurgicallyresectedlungcarcinoma AT sugimotoryo frequencyofdnamismatchrepairdeficiencyisverylowinsurgicallyresectedlungcarcinoma AT osakabemitsumasa frequencyofdnamismatchrepairdeficiencyisverylowinsurgicallyresectedlungcarcinoma AT uesuginoriyuki frequencyofdnamismatchrepairdeficiencyisverylowinsurgicallyresectedlungcarcinoma AT shionosatoshi frequencyofdnamismatchrepairdeficiencyisverylowinsurgicallyresectedlungcarcinoma AT endohmakoto frequencyofdnamismatchrepairdeficiencyisverylowinsurgicallyresectedlungcarcinoma AT ogatashinya frequencyofdnamismatchrepairdeficiencyisverylowinsurgicallyresectedlungcarcinoma AT saitohajime frequencyofdnamismatchrepairdeficiencyisverylowinsurgicallyresectedlungcarcinoma AT maemondomakoto frequencyofdnamismatchrepairdeficiencyisverylowinsurgicallyresectedlungcarcinoma AT sugaitamotsu frequencyofdnamismatchrepairdeficiencyisverylowinsurgicallyresectedlungcarcinoma |